KEGG   Helicobacter pylori UM037: K750_05180
Entry
K750_05180        CDS       T02659                                 
Name
(GenBank) BNR repeat-like domain protein
  KO
K23083  3-deoxy-D-manno-octulosonic acid-hydrolase
Organism
hpyi  Helicobacter pylori UM037
Pathway
hpyi00540  Lipopolysaccharide biosynthesis
hpyi01100  Metabolic pathways
Module
hpyi_M00867  KDO2-lipid A modification pathway
Brite
KEGG Orthology (KO) [BR:hpyi00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    K750_05180
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:hpyi01005]
    K750_05180
Lipopolysaccharide biosynthesis proteins [BR:hpyi01005]
 Lipid A
  K750_05180
SSDB
Motif
Pfam: BNR_2 DUF3741
Other DBs
NCBI-ProteinID: AGL69980
UniProt: R4QH21
LinkDB
Position
568391..569509
AA seq 372 aa
MEPSRNRLKHAAFFVGLFIVLFLIAMKRQTPPYAFVHNQTLVTQNPPYFTQLTIPKPDDA
LSVHASALINLPNDNLLSAYFSGTKEGAKDVKISANLFDGKINRWSEAFILLTKEELSKN
AHEYIKKLGNPLLFLHDDKILLFVVGVSMGGWATSKIYQFESTLEPIHFKFARKLSLSPF
LNLSHLIKNKPLNTTDGGFMLPLYHELATQYPLLLKFDKQNNPRELLRPNTLNHQLQPSL
TPFKDCAVMAFRNHSFKDNIMLETCKTPTAWQKPMLTNLKNLNDALNLINLNEELYLIHN
PSDLSLRRKELWLSKLENSNSFKTLKVLDKANEVSYPSYSLNSHFIDIVYTYNRSHIKHI
RFNMAYLKSLLK
NT seq 1119 nt   +upstreamnt  +downstreamnt
ttggaaccttcaagaaatcgcctaaagcatgccgccttttttgtggggctttttattgtt
ttatttttaattgcaatgaagcgccaaacccccccctatgcttttgtgcacaatcaaacc
cttgttactcaaaaccccccctatttcactcagctcactatccctaaaccagatgacgct
ttaagcgtgcatgcgagcgctttaatcaacttgcctaacgataacctcttgagtgcttat
tttagcggcactaaagaaggggcaaaagatgtgaaaatcagcgcgaatctttttgatggc
aagattaatcgctggagcgaagccttcattcttttaaccaaggaagagctttccaaaaac
gcgcatgaatacatcaaaaaactaggtaaccccttgctttttttgcatgacgataaaatt
ttgttatttgtcgtaggggtgagcatgggcgggtgggccacttctaaaatctatcaattt
gaaagcactttagagccgattcattttaagtttgcgcgaaagctctctttaagccctttt
ttaaacttaagccatttgataaaaaataagcctttaaacaccactgatggcgggtttatg
ctaccgctctatcatgaattagccacccaataccccttgttgttgaaatttgacaaacaa
aataacccaagagagcttttaaggcctaataccctaaaccaccagctccagccaagccta
accccctttaaagactgcgctgtcatggcgtttaggaaccattcttttaaagataatatc
atgctagaaacctgtaaaactcctaccgcttggcaaaaacccatgcttacgaatttgaaa
aacttgaatgacgctttgaatttgatcaatttaaacgaagaattgtatttgatccacaac
cctagcgatttatctttgcgtcgtaaagaactctggctttctaaattggaaaactccaac
tcgtttaaaaccttaaaagttttagacaaagccaatgaagtgagttacccaagctatagt
cttaactctcattttatagatattgtctatacctataaccgctctcatatcaaacacatc
cgtttcaatatggcttatttaaaatcccttctcaagtaa

DBGET integrated database retrieval system