KEGG   Helicobacter pylori Aklavik86: HPAKL86_01960
Entry
HPAKL86_01960     CDS       T02353                                 
Name
(GenBank) hypothetical protein
  KO
K23083  3-deoxy-D-manno-octulosonic acid-hydrolase
Organism
hpyk  Helicobacter pylori Aklavik86
Pathway
hpyk00540  Lipopolysaccharide biosynthesis
hpyk01100  Metabolic pathways
Module
hpyk_M00867  KDO2-lipid A modification pathway
Brite
KEGG Orthology (KO) [BR:hpyk00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    HPAKL86_01960
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:hpyk01005]
    HPAKL86_01960
Lipopolysaccharide biosynthesis proteins [BR:hpyk01005]
 Lipid A
  HPAKL86_01960
SSDB
Motif
Pfam: BNR_2 DUF3741
Other DBs
NCBI-ProteinID: AFX89409
UniProt: K7Y1G5
LinkDB
Position
complement(384039..385157)
AA seq 372 aa
MEHSRNRLKHAAFFVGLFIVLFLIIMKRQTPPYAFLHNQTLSTKSPPYFTQLTIPKPDDA
LSVHASALISLPNDNLLSAYFSGTKEGARDVKISANLFDGKINRWSEAFIILTKEELSYY
SHEYIKKLGNPLLFLHGDKILLFVVGVSMGGWATSKIYQLESALEPIHFKFVRKLSLSPF
LNLSHLIKNKPLNTTDGGFMLPLYHELATQYPLLLKFDKHNNPRELLRPNALNHQLQPSL
TPFKDCAVMAFRNHSFKDSLMLETCKTPTAWQKPILTNLKNLNDALNLINLNQELYLIHN
PSDLSMRRKELLLSKLENSNSFRTLKILDKANEVSYPSYSFNSHFIDIVYTYNRSHIKHI
RFNMAYLKSLLK
NT seq 1119 nt   +upstreamnt  +downstreamnt
ttggaacattcaagaaatcgcctaaagcatgccgccttttttgtggggctttttatcgtt
ttatttttaattataatgaagcgccaaacccccccctatgcttttttgcacaatcaaacc
ctttcaaccaaaagccccccctatttcacacaactcactatccctaaaccagatgacgct
ttaagcgtgcatgcgagcgctttaatcagcttgcctaacgataaccttttgagcgcttat
tttagcggcactaaagaaggggcaagggatgtgaaaatcagcgcaaatctctttgatggt
aagatcaatcgctggagtgaagccttcatcattttaaccaaagaagagctttcttattat
tcgcatgaatatatcaaaaaactaggtaaccccttgctttttttgcatggcgataaaatt
ttgttgtttgtcgtaggggtgagcatgggcgggtgggccacttctaaaatctatcaactt
gaaagcgctttagagccgattcactttaaatttgtgcgaaaactctctttaagccctttt
ttaaacttaagccatttgataaaaaataagcctttaaacaccaccgatggcgggtttatg
ctaccgctttatcacgaattagccacccaataccccttattattgaaatttgacaaacac
aataatccaagagaacttttaaggcctaatgccctaaaccaccagctccagccaagccta
accccctttaaagactgcgctgtcatggcgtttagaaaccattcttttaaagatagcctc
atgctagaaacctgtaaaacccccaccgcttggcaaaaacccatacttacgaatttgaaa
aacttgaatgacgctttgaatttgatcaatttaaaccaagaattgtatttgatccacaac
cctagcgatttatcaatgcgccgtaaagaactcttgctttctaaattagaaaactcaaac
tcttttagaaccttaaaaattttagataaagccaatgaagtgagttacccaagttatagt
tttaattctcattttatagatattgtctatacctacaaccgctctcatatcaaacacatc
cgttttaatatggcttatttaaaatcccttctcaagtga

DBGET integrated database retrieval system