KEGG   Helicobacter pylori OK310: HPOK310_0756
Entry
HPOK310_0756      CDS       T02542                                 
Name
(GenBank) hypothetical protein
  KO
K23083  3-deoxy-D-manno-octulosonic acid-hydrolase
Organism
hpyl  Helicobacter pylori OK310
Pathway
hpyl00540  Lipopolysaccharide biosynthesis
hpyl01100  Metabolic pathways
Module
hpyl_M00867  KDO2-lipid A modification pathway
Brite
KEGG Orthology (KO) [BR:hpyl00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    HPOK310_0756
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:hpyl01005]
    HPOK310_0756
Lipopolysaccharide biosynthesis proteins [BR:hpyl01005]
 Lipid A
  HPOK310_0756
SSDB
Motif
Pfam: BNR_2 DUF3741
Other DBs
NCBI-ProteinID: BAM98184
UniProt: M5A996
LinkDB
Position
793048..794166
AA seq 372 aa
MEHSRNRLKHAAFFVGLFIVLFLMIMKHQTPPYAFLHNQTLSTKSPPYFTQLTIPKPNDA
LSVHASALISLPNDNLLSAYFSGTKEGARDVKISANLFDSKINRWSEAFIILTKEELSYY
SHEYIKKLGNPLLFLHDDKILLFVVGVSMGGWATSKIYQLESALEPIRFKFVRKLSLSPF
LNLSHLIKNKPLNTTDGGFMLPLYHELATQYPLLLKFDKHNNPRELLRPNALNHQFQPSL
TPFKDCAIMAFRNYSFKDNLMLETCKTPTAWQKPMLTNLKNLNDALNLINLNKELYLIHN
PSDLSLRRKELLLSKLENPNSFKTLKILDKANEVSYPSYSLNSHFIDIVYTYNRSHIKHI
RFNMAYLKSLLK
NT seq 1119 nt   +upstreamnt  +downstreamnt
ttggaacattcaagaaatcgcctaaaacatgccgccttttttgtggggctttttatcgtt
ttatttttaatgataatgaagcaccaaacccccccctatgcttttttgcacaatcaaacc
ctttcaaccaaaagccccccctatttcacacagctcactatccctaaaccaaatgacgct
ttaagcgtgcatgcgagcgctttaatcagcttgcctaacgataaccttttgagcgcttat
tttagcggcactaaagaaggagcaagggatgtgaaaatcagcgcgaatctttttgacagc
aagatcaatcgttggagcgaagccttcattattttaaccaaagaagagctttcttattat
tcgcatgagtacatcaaaaaactaggtaaccccttgctttttttgcatgacgataaaatt
ttattgtttgtcgtaggggtgagcatgggcgggtgggccacttctaaaatctatcaactt
gaaagcgctttagagccgattcgttttaagtttgtgcgaaaactctccttaagccctttt
ttaaacttaagccatttgataaaaaataagcctttaaacaccactgatggcgggtttatg
ctaccactctatcacgaattagccacccaataccccttgttgttgaaatttgacaaacac
aataacccaagagagcttttaaggcctaatgctctaaaccaccagttccagccaagccta
accccctttaaagattgcgctatcatggcgtttagaaactattcttttaaagataacctc
atgctagaaacctgtaaaacccccaccgcttggcaaaaacccatgcttacgaatttgaaa
aacttgaatgacgctttgaatttgatcaatttaaacaaagaattgtatttgatccacaac
cctagcgatttatctttgcgtcgtaaagaactcttgctttctaaattagaaaacccaaac
tcttttaaaaccttaaaaattttagataaagcgaatgaagtgagttacccaagctatagt
cttaattctcattttatagatattgtctatacctacaaccgctctcatatcaaacacatc
cgttttaatatggcctatttaaaatcccttctcaagtga

DBGET integrated database retrieval system