KEGG   Helicobacter pylori UM299: K749_01610
Entry
K749_01610        CDS       T02661                                 
Name
(GenBank) hypothetical protein
  KO
K23083  3-deoxy-D-manno-octulosonic acid-hydrolase
Organism
hpym  Helicobacter pylori UM299
Pathway
hpym00540  Lipopolysaccharide biosynthesis
hpym01100  Metabolic pathways
Module
hpym_M00867  KDO2-lipid A modification pathway
Brite
KEGG Orthology (KO) [BR:hpym00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    K749_01610
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:hpym01005]
    K749_01610
Lipopolysaccharide biosynthesis proteins [BR:hpym01005]
 Lipid A
  K749_01610
SSDB
Motif
Pfam: BNR_2 DUF3741
Other DBs
NCBI-ProteinID: AGL67714
LinkDB
Position
complement(1353039..1354157)
AA seq 372 aa
MEHSRNRLKHAAFFVGLFIVLFLMIMKRQTPPYAFLHNQTLSTKSPPYFTQLTIPKPNDA
LSVHASALISLPNDNLLSAYFSGTKEGARDVKISANLFDSKINRWSEAFVILTKEELSYY
SHEYIKKLGNPLLFLHDDKILLFVVGVSMGGWATSKIYQLESALEPIHFKFVRKLSLSPF
LNLSHLIKNKPLSTTDGGFMLPLYHELATQYPLLLKFDKHNNPRELLRPNALNYQLQPSL
TPFKDCAIMAFRNHSFKDSLMLETCKTPTAWQKPMLTNLKNLNDALNLINLNKELYLIHN
PSDSSLRRKELLLSKLENSNSFKTLKILDKANEVSYPSYSLNSHFIDIVYTYNRSHIKHI
RFNMAYLKSLLK
NT seq 1119 nt   +upstreamnt  +downstreamnt
ttggaacattcaagaaatcgcctaaagcatgccgccttttttgtggggctttttatcgtt
ttatttttaatgataatgaagcgccaaacccccccctatgcttttttgcacaatcaaacc
ctttcaaccaaaagccccccctatttcactcaactcactatccctaaaccaaatgacgct
ttaagcgtgcatgcgagcgctttaatcagcttgcctaacgataaccttttgagcgcttat
tttagcggcactaaagaaggggcaagggatgtgaaaatcagcgcgaatctttttgacagc
aagatcaatcgctggagcgaagccttcgttattttaaccaaagaagagctttcttattat
tcgcatgaatacatcaaaaaactaggtaaccccttgctttttttgcatgacgataaaatt
ttgttgtttgttgtgggggtgagcatgggcgggtgggccacttctaaaatctatcaactt
gaaagtgctttagagccgattcattttaaatttgtgcgaaaactctctttaagccctttt
ttaaacttaagccatttgataaaaaataagcctttaagcaccactgatggcgggtttatg
ctaccgctttatcacgaattagccacccaataccccttattgttgaaatttgacaaacac
aataacccaagagagcttttaaggcctaatgccctaaactaccagctccagccaagtcta
accccctttaaagactgtgccatcatggcgtttagaaaccattctttcaaagatagtctc
atgctagaaacctgtaaaacccccaccgcttggcaaaaacccatgcttacgaatttgaaa
aacttgaatgacgctttgaatttgatcaatttaaacaaagaattgtatttgatccacaac
cctagcgattcatctttgcgtcgtaaagaactcttgctttctaaattagaaaactcaaac
tcttttaaaaccttaaaaattttagataaagcaaatgaagtgagttacccaagttatagt
cttaattctcattttatagatattgtttatacctacaaccgctctcatatcaaacacatc
cgtttcaatatggcttatttaaaatcccttctcaagtga

DBGET integrated database retrieval system