KEGG   Helicobacter pylori OK113: HPOK113_0596
Entry
HPOK113_0596      CDS       T02510                                 
Name
(GenBank) hypothetical protein
  KO
K23083  3-deoxy-D-manno-octulosonic acid-hydrolase
Organism
hpyo  Helicobacter pylori OK113
Pathway
hpyo00540  Lipopolysaccharide biosynthesis
hpyo01100  Metabolic pathways
Module
hpyo_M00867  KDO2-lipid A modification pathway
Brite
KEGG Orthology (KO) [BR:hpyo00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    HPOK113_0596
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:hpyo01005]
    HPOK113_0596
Lipopolysaccharide biosynthesis proteins [BR:hpyo01005]
 Lipid A
  HPOK113_0596
SSDB
Motif
Pfam: BNR_2 DUF3741
Other DBs
NCBI-ProteinID: BAM96504
UniProt: M5A4V9
LinkDB
Position
complement(627642..628760)
AA seq 372 aa
MEHSRNRLKHAAFFVGLFIVLFLIIMKRQTPPYAFAHNQTLSTESPPYFTQLTIPKPNDA
LSVHASALISLPNDNLLSAYFSGTKEGARDVKISANLFDSKINRWSEAFILLTKEELSYY
SHEYIKKLGNPLLFLHDDKILLFVVGVSMGGWATSKIYQLESALEPIRFKFVQKLSLSPF
LNLSHLIRNKPLSTTDGGFMLPLYHELATQYPLLLKFDQQNNPRELLRPNALNNQLQPSL
TPFKDCAIMAFRNHSFKDSLMLETCKTPTAWQKPTLTNLKNLNDALNLINLNKELYLIHN
PSDLSLRRKELLLSKLENSNSFKTLKILDKANEVSYPSYSLNPHFIDIVYTYNRSHIKHI
RFNMAYLKSLLK
NT seq 1119 nt   +upstreamnt  +downstreamnt
ttggaacattcaagaaatcgcctaaaacatgccgccttttttgtggggctttttatcgtt
ttatttttaattataatgaagcgccaaacccccccctatgcttttgcacacaatcaaacc
ctttcaaccgagagccccccctatttcactcagctcactatccctaaaccaaatgacgct
ttaagcgtgcatgcgagcgctttaatcagcttgcctaacgataaccttttgagcgcttat
tttagcggcactaaagaaggggcaagggatgtgaaaatcagcgcgaatctttttgacagc
aagatcaatcgctggagcgaagccttcattcttttaaccaaagaagagctttcttattat
tcgcatgaatacatcaaaaaactaggtaaccccttgctttttttgcatgacgataaaatt
ttgttgtttgttgtaggggtgagcatgggcgggtgggccacttctaaaatctatcaactt
gaaagcgctttagagccgattcgttttaaatttgtgcaaaaactctctttaagccctttt
ttaaacttaagccatttgataaggaataagcctttaagcaccactgatggcgggtttatg
ctaccgctctatcacgaattagccacccaataccccttgttgttgaaatttgaccaacaa
aataacccaagagagcttttaaggcctaatgccctaaacaaccagctccagccaagccta
accccctttaaagattgcgctatcatggcgtttagaaaccattcttttaaagatagcctc
atgctagaaacctgtaaaacccccactgcttggcaaaaacccacgcttacgaatttgaaa
aacttgaatgacgctttgaatttgatcaatttaaacaaagaattgtatttgatccacaac
cctagcgatttatcactgcgccgtaaagaactcctgctttctaaattagaaaactccaac
tcgtttaaaaccttaaagattttagataaagcgaatgaagtgagttacccaagctatagt
cttaatcctcattttatagatattgtctatacctacaaccgctctcatatcaaacacatc
cgttttaatatggcttatttaaaatcccttctcaagtga

DBGET integrated database retrieval system