KEGG   Helicobacter pylori UM066: K751_03520
Entry
K751_03520        CDS       T02660                                 
Name
(GenBank) BNR repeat-like domain protein
  KO
K23083  3-deoxy-D-manno-octulosonic acid-hydrolase
Organism
hpyu  Helicobacter pylori UM066
Pathway
hpyu00540  Lipopolysaccharide biosynthesis
hpyu01100  Metabolic pathways
Module
hpyu_M00867  KDO2-lipid A modification pathway
Brite
KEGG Orthology (KO) [BR:hpyu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    K751_03520
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:hpyu01005]
    K751_03520
Lipopolysaccharide biosynthesis proteins [BR:hpyu01005]
 Lipid A
  K751_03520
SSDB
Motif
Pfam: BNR_2 DUF3741
Other DBs
NCBI-ProteinID: AGL71279
UniProt: R4QD92
LinkDB
Position
932873..933991
AA seq 372 aa
MEHSRNRLKHAAFFVGLFIVLFLMIMKRQTPPYAFVHNQTLSTKNPPYFTQLTIPKPNDA
LSVHASALISLPNDNLLSAYFSGTKEGARDVKISANLFDNKINRWSEAFIILTKEELSYY
SHEYIKKLGNPLLFLHDDKILLFVVGVSMGGWATSKIYQLESTLEPIHFKFVQKLSLSPF
LNLSHLIKNKPLNTTDGGFMLPLYHELATQYPLLLKFDKHNNPRELLRPNALNYQLQPSL
TPFKDCAIMAFRNHSFKDSLMLETCKTPTAWQKPMLTNLKNLNDALNLINLNKELYLIHN
PSDLSLRRKELLLSKLENSNSFKTLKILDKANEVSYPSYSLNSHFIDIVYTYNRSHIKHI
RFNMAYLKSLLK
NT seq 1119 nt   +upstreamnt  +downstreamnt
ttggaacattcaagaaatcgcctaaaacatgccgcctttttcgtggggctttttatcgtt
ttatttttaatgataatgaagcgccaaacccccccctatgcttttgtgcacaatcaaacc
ctttcaaccaaaaaccccccctatttcactcagctcactatccctaaaccaaatgacgct
ttaagcgtgcatgcgagcgctttaatcagcttgcctaacgataaccttttgagcgcttat
tttagcggcactaaagaaggggcaagggatgtgaaaatcagcgcgaatctttttgacaac
aagatcaatcgttggagcgaagccttcattattttaaccaaagaagagctttcttattat
tcgcatgaatacatcaaaaaactaggtaaccctttgctttttttgcatgacgataaaatt
ttgttgtttgtcgtaggggtgagcatgggcgggtgggccacttctaaaatctatcaactt
gaaagcactttagagccgattcattttaaatttgtgcaaaaactctctttaagccctttt
ttaaacttaagccatttgataaaaaataagcctttaaacaccactgatggcgggtttatg
ctaccgctttatcacgaattagccacccaataccccttattgttgaaatttgacaaacac
aataacccaagagagcttttaaggcctaatgccctaaactaccagctccagccaagtcta
accccctttaaagactgtgccatcatggcgtttagaaaccattctttcaaagatagtctc
atgctagaaacctgtaaaacccccaccgcttggcaaaaacccatgcttacgaatttgaaa
aacttgaatgacgctttgaatttgatcaatttaaacaaagaattgtatttgatccacaac
cctagcgatttatctttgcgccgtaaagaactcttgctttctaaattagaaaactcaaac
tcttttaaaaccttaaaaattttagataaagcaaatgaagtgagttacccaagctatagt
cttaactctcattttatagatattgtctatacctacaaccgctctcatatcaaacatatt
cgttttaatatggcctatttaaaatcccttctcaagtga

DBGET integrated database retrieval system