KEGG   Helicobacter pylori 52: HPKB_0764
Entry
HPKB_0764         CDS       T01898                                 
Name
(GenBank) hypothetical protein
  KO
K23083  3-deoxy-D-manno-octulosonic acid-hydrolase
Organism
hpz  Helicobacter pylori 52
Pathway
hpz00540  Lipopolysaccharide biosynthesis
hpz01100  Metabolic pathways
Module
hpz_M00867  KDO2-lipid A modification pathway
Brite
KEGG Orthology (KO) [BR:hpz00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    HPKB_0764
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:hpz01005]
    HPKB_0764
Lipopolysaccharide biosynthesis proteins [BR:hpz01005]
 Lipid A
  HPKB_0764
SSDB
Motif
Pfam: BNR_2 DUF3741
Other DBs
NCBI-ProteinID: ACX99356
UniProt: D0JZT6
LinkDB
Position
803124..804242
AA seq 372 aa
MEHSRNRLKHAAFFVGLFIVLFLMIMKRQTPPYAFLHNQTLSTESPPYFTQLTIPKPNDA
LSVHASALISLPNDNLLSAYFSGTKEGARDVKISVNLFDSKINRWSEAFIILTKEELSHY
SHEYIKKLGNPLLFLHGDKILLFVVGVSMGGWATSKIYQLESALEPIRFKFARKLSLSPF
LNLSHLIKNKPLNTTDGGFMLPLYHELATQYPLLLKFDKQNNPRDLLRPNALNHQLQPSL
TPFKDCAAMAFRNHSFKDSLMLETCKTPTAWQKPMLTNLKNLNDALNLINLNKELYLIHN
PSDLSLRRKELLLSKLENPNSFKTLKILDKADEVSYPSYSLNPHFIDIVYTYNRSHIKHI
RFNMAYLKSLLK
NT seq 1119 nt   +upstreamnt  +downstreamnt
ttggaacattcaagaaatcgcctaaaacatgccgcctttttcgtggggctttttatcgtt
ttatttttaatgataatgaaacgccaaacccccccctatgcttttttgcacaatcaaacc
ctttcaaccgagagccccccttatttcactcagctcaccatccctaaaccaaatgacgct
ttaagcgtgcatgcgagcgctttaatcagcttgcctaacgataaccttttaagcgcttat
tttagcggcactaaagaaggggcaagggatgtgaaaatcagcgtgaatctttttgacagc
aagatcaatcgctggagcgaagctttcattattttaaccaaagaagagctttctcattat
tcgcatgaatatatcaaaaaactaggtaaccccttgctttttttgcatggcgataaaatt
ttattgtttgtcgtaggggtgagcatgggcgggtgggccacttctaaaatctatcaactt
gaaagcgctttagagccgattcgttttaaatttgcgcgaaaactctccttaagccctttt
ttaaacttaagccatttgataaaaaataagcctttaaacaccactgatggcgggtttatg
ctaccactctatcacgaattagccacccaataccccttgttgttgaaatttgacaaacaa
aataacccaagagatcttttaaggcctaatgccctaaaccaccagctccaaccaagccta
accccctttaaagattgcgctgccatggcgtttagaaaccattcttttaaagatagcctc
atgctagaaacctgtaaaacccccaccgcttggcaaaaacccatgctgacgaatttgaaa
aacttgaatgacgctttgaatttgatcaatttaaacaaagaattgtatttgatccacaac
cctagcgatttatctttgcgccgtaaagaactcttgctttctaaattagaaaacccaaac
tcttttaaaaccttaaaaattttagataaagcggatgaagtgagttacccaagctatagt
cttaatcctcattttatagatattgtctatacctacaaccgctctcatatcaaacacatc
cgttttaatatggcttatttaaaatcccttctcaagtga

DBGET integrated database retrieval system