KEGG   Halovivax ruber: Halru_1082
Entry
Halru_1082        CDS       T02402                                 

Definition
(GenBank) NAD dependent epimerase/dehydratase family protein
  KO
K19660  L-arabinose 1-dehydrogenase [NAD(P)+] [EC:1.1.1.376]
Organism
hru  Halovivax ruber
Pathway
hru00053  Ascorbate and aldarate metabolism
hru01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hru00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    Halru_1082
Enzymes [BR:hru01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.376  L-arabinose 1-dehydrogenase [NAD(P)+]
     Halru_1082
SSDB
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD NAD_binding_10 NAD_binding_4 RmlD_sub_bind Polysacc_synt_2 Semialdhyde_dh
Other DBs
NCBI-ProteinID: AGB15699
UniProt: L0IAD7
LinkDB
Position
complement(1112109..1112894)
AA seq 261 aa
MAIVAITGGTGNVGRQALGALDEHETTILARSDADDIDVVTLDVTDRDRFVDVLDGHDTL
VHLAANPSPWASWDEVLDANVDGTYNAYHAAVENDLDRVVFASTNHTMHMYNAADTAEPE
SLVEQPRPVFPDDPPRPDSPYGISKVAGEAIGTYFADRHGLTVVNLRIGWLLNDESLRET
QSEDDDHARFARAMYLSPRDCRDALRKSVTHSIEESPLTCHVVSANDERYFSIVEAQTEL
GYRPRDNARQVLDSGTSTEQE
NT seq 786 nt   +upstreamnt  +downstreamnt
atggcaatcgttgcgatcaccggtggcaccggcaacgtcgggcgacaggcactcggtgca
ctcgacgagcacgagacgacgatactggcccgcagcgatgccgacgacatcgacgtcgtc
accctcgacgtaaccgatcgggaccggttcgtcgacgtcctcgacgggcacgacacgctc
gtacatctggcggcgaacccgtcaccgtgggcctcgtgggacgaggtgctcgacgcgaac
gtcgacggaacgtacaacgcctatcacgccgccgtcgagaacgacctcgaccgcgtcgtc
ttcgcgagtacgaaccacacgatgcacatgtacaacgccgccgacacggccgagcccgag
tcgctcgtcgaacagcctcgccccgtgtttcccgacgaccccccacgccccgactcaccg
tacggcatcagcaaggtcgcgggcgaagccatcgggacgtacttcgcggatcgccacggc
ctgacggtcgtcaacctgcgcatcggctggttgctgaacgacgagtcgcttcgtgagacc
cagtccgaggacgacgaccacgccaggttcgcccgcgcgatgtacctcagtccgcgagac
tgccgcgatgcccttcgtaaatccgtcactcacagcatcgaggagtcgccgctgacctgt
cacgtcgtctccgcgaacgacgaacgatacttctcgatcgtcgaggcccagacggagctc
ggctatcgaccgcgggacaatgcaaggcaggttctcgacagtgggacatcgactgaacag
gagtag

DBGET integrated database retrieval system