KEGG   Homo sapiens (human): 100129543
Entry
100129543         CDS       T01001                                 
Symbol
ZNF730
Name
(RefSeq) zinc finger protein 730
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100129543 (ZNF730)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    100129543 (ZNF730)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    100129543 (ZNF730)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 KRAB zf-C2H2_6 XPA_N zf_UBZ Zn-ribbon_8 zf-C2H2_jaz zf-C2H2_11 zf-AN1 Zn_ribbon_SprT zinc_ribbon_15 DNA_RNApol_7kD
Other DBs
NCBI-GeneID: 100129543
NCBI-ProteinID: NP_001264332
HGNC: 32470
Ensembl: ENSG00000183850
Pharos: Q6ZMV8(Tdark)
UniProt: Q6ZMV8
LinkDB
Position
19:23075211..23147221
AA seq 503 aa
MGALTFRDVAIEFSLEEWQCLDTEQQNLYRNVMLDNYRNLVFLGIAVSKPDLITCLEQEK
EPWNLKTHDMVAKPPVICSHIAQDLWPEQGIKDYFQEVILRQYKKCRHENLLLRKGCKNV
DEFKMHKKGYNRHNQCLTTSHSKIFQCDKYVKVFHKFSNSNRHKIRHTSKKPFKCKECGK
LFCILSHLAQHKKIHTGEKSYKCEEYGKAFNESSNCTTHKRITEKKPYKCKECGKAFNWF
SHFTTHKRIHTGEKPYQCEKCGKFFNQSTNLTTHKRIHTGEKPYKCEECGKAFNQSSNLT
EHKKIHTKEQPYKCEKCGKAFKWSSTLTKHKRIHNGEKPYKCEECGKAFNRSSTLNRHKI
THTGGKPYKYKECGKAFNQSSTLTIHKIIHTVEKFYKCEECGKAFSRISHLTTHKRIHTG
EKPYKCEECGRAFNQSSTLTTHKRIHTGEKPYECEECGKAFNRSSTLTTHKIIHSGEKIY
KCKECGKAFRRFSHLTRHKTIHT
NT seq 1512 nt   +upstreamnt  +downstreamnt
atgggagcgttgacatttagagatgtggccatagaattctctctggaggagtggcaatgt
ctggacaccgaacaacagaatttatatagaaatgtaatgttagataactacagaaacctg
gtcttcctgggtattgctgtctcaaagccagacctgatcacctgtctggagcaagaaaaa
gagccttggaatttgaagacacatgatatggtagccaaacccccagttatatgttctcat
attgcccaagacctttggccagagcaaggcataaaagattatttccaagaagtcatactg
agacaatataaaaaatgtagacatgagaatttactgttaagaaaaggctgtaaaaatgtg
gatgagtttaagatgcacaaaaaaggttataatagacataaccagtgtttgacaacttcc
catagcaaaatatttcagtgtgacaaatatgtgaaagtctttcataaattttcaaattca
aacagacataagataagacatacttcgaagaaacctttcaaatgtaaagaatgtggaaaa
ttattttgcattctttcacacttagctcaacataaaaaaattcatactggagagaaatcc
tacaaatgtgaagaatatggcaaagcctttaatgagtcctcaaactgtactacacataaa
agaattactgagaaaaaaccttacaaatgtaaagaatgtggcaaagcctttaactggttt
tcacattttactacacataagagaattcatactggagaaaaaccctaccaatgtgagaaa
tgtggcaaattttttaaccaatccacaaaccttactacacataaaagaattcatactgga
gagaaaccctataaatgtgaagaatgtggcaaagcctttaaccagtcctcaaaccttact
gaacataagaaaattcatactaaagagcaaccatacaaatgcgaaaaatgtggcaaagct
tttaagtggtcctcaacccttacaaaacataaaagaattcataatggagaaaaaccctac
aaatgtgaagaatgtggcaaagcttttaaccgatcctcaacccttaatagacataagata
actcatactggagggaaaccctacaaatataaagaatgtggtaaagcttttaaccaatcc
tcaactcttactatacataagataattcatactgtagagaaattttacaaatgtgaagaa
tgtggcaaagcctttagccgtatctcacaccttactacacataagagaattcatactgga
gagaaaccctacaaatgtgaagaatgtggcagagctttcaaccagtcctcaacccttact
acacataaaagaattcatactggagagaaaccctatgaatgtgaagaatgtggcaaagct
tttaaccggtcctcaaccctcactacacataagataattcattctggggaaaaaatctac
aaatgtaaagaatgtggtaaagcctttaggcggttctcacaccttactaggcataagaca
attcatacataa

KEGG   Homo sapiens (human): 100129842
Entry
100129842         CDS       T01001                                 
Symbol
ZNF737, ZNF102
Name
(RefSeq) zinc finger protein 737
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100129842 (ZNF737)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    100129842 (ZNF737)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    100129842 (ZNF737)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_6 KRAB zf-C2H2_jaz XPA_N Zn-ribbon_8 Zn_ribbon_SprT zinc_ribbon_15
Other DBs
NCBI-GeneID: 100129842
NCBI-ProteinID: NP_001152765
OMIM: 603984
HGNC: 32468
Ensembl: ENSG00000237440
Pharos: O75373(Tdark)
UniProt: O75373
LinkDB
Position
19:complement(20530276..20565781)
AA seq 536 aa
MGPLQFRDVAIEFSLEEWHCLDTAQRNLYRNVMLENYRNLVFLGIVVSKPDLITCLEQGK
KPLTMKKHEMVANPSVTCSHFARDLWPEQSIKDSFQKVTLRRYENYGHDNLQFKKGCESV
DECKVHKRGYNGLNQYLTTTQSKIFQCDKYVKVIHKFSNSNRHKIRHTGKKPFKCIECGK
AFNQSSTLTTHKKIHTGEKPFKCEECGKAFNWSSHLTTHKRIHTGEKRYKCEDCGKAFSR
FSYLTAHKIIHSGEKPYKCEECGKAFKRSSNLTTHKIIHTGEKPYKCEECGKAFKRSSIL
TAHKIIHSGEKPYKCEECGKAFKHPSVLTTHKRIHTGEKPYKCEECGRAFKYFSSLTTHK
IIHSGEKPYKCEECGKAFNWSSHLTTHKRIHTGEKPYKCEECGEAFKYSSSLTTHKIIHT
GQQPFKCEECGKAFKCFSILTTHKRIHTGEKPYKCEECGKAFNSSSHLTAHKRIHTGEKP
YKCERCGKAFKRSFILTRHKRIHTGEKPYKCEECGKGFKCPSTLTTHKVIHTGEKL
NT seq 1611 nt   +upstreamnt  +downstreamnt
atggggccattgcaatttagagacgtggccatagaattctctctggaggagtggcattgc
ctggacactgcacagcggaatttatataggaatgtgatgttagagaactacagaaacctg
gtcttccttggtattgttgtctctaagccagacctcatcacctgtctggagcaaggaaaa
aaacctttgaccatgaagaaacatgagatggtagccaacccctcagttacgtgttctcat
tttgcccgagatctttggccagagcagagcataaaagattctttccaaaaagtgacactg
agaagatatgaaaactatggacatgacaatttacagtttaaaaagggctgtgaaagtgta
gatgagtgtaaggtgcacaaaagaggttataatggacttaaccaatatttgacaactact
caaagcaaaatatttcagtgtgataaatatgtgaaagtcattcataaattttcaaattca
aacagacataagataagacatactggaaaaaaacctttcaaatgtatagaatgtggcaaa
gcttttaaccagtcttcaacccttactacacataagaaaattcatactggggagaaaccc
ttcaaatgtgaagaatgtggcaaagccttcaactggtcctcacaccttactacacataag
agaattcatactggagagaaacggtacaaatgtgaagactgtggcaaagcctttagccgg
ttttcataccttactgcacataagataattcatagtggagagaaaccctacaaatgtgaa
gaatgtggcaaggcctttaagcgctcctctaaccttactacacataagataattcatact
ggagagaaaccctacaaatgtgaagaatgtggcaaggcctttaagcgctcctctatcctt
actgcgcataagataattcatagcggagagaaaccctacaaatgtgaagaatgtggcaaa
gcctttaagcacccctctgtccttactacacataaaagaattcatactggagagaaaccc
tacaaatgtgaagaatgtggcagagcctttaagtacttctcatcccttactacacacaag
ataattcatagtggagagaaaccctacaaatgtgaagaatgtggcaaagccttcaactgg
tcctcacaccttactacacataagagaattcatactggagagaaaccctacaaatgtgaa
gaatgtggcgaagcctttaagtactcctcttcccttactacacataagataatccatact
ggacagcaacccttcaagtgtgaagaatgtggcaaggcctttaagtgcttctctatcctt
actacacataagagaattcatactggagagaaaccctacaaatgtgaagaatgtggcaaa
gccttcaactcgtcctcacaccttactgcacataagagaattcatactggagagaaaccc
tacaaatgtgaacgatgtggcaaggcttttaagcgctcctttatccttactagacataag
agaattcatactggagagaaaccctacaaatgtgaagaatgtggcaaaggctttaagtgc
ccctctacccttactacacataaggtaattcatactggagagaaactataa

KEGG   Homo sapiens (human): 100131017
Entry
100131017         CDS       T01001                                 
Symbol
ZNF316, MZF-3
Name
(RefSeq) zinc finger protein 316
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100131017 (ZNF316)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    100131017 (ZNF316)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    100131017 (ZNF316)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 KRAB zf-C2H2_jaz Zn-ribbon_8 zf-C2H2_6 Zn_ribbon_SprT zf-C2HC_2 zf-Di19 HVO_2753_ZBP
Other DBs
NCBI-GeneID: 100131017
NCBI-ProteinID: NP_001265488
HGNC: 13843
Ensembl: ENSG00000205903
Pharos: A6NFI3(Tdark)
UniProt: A6NFI3
LinkDB
Position
7:6637318..6658279
AA seq 1004 aa
MAALHTTPDSPAAQLERAEDGSECDPDQEEEEEEEEKGEEVQEVEEEEEEIVVEEEEEGV
AEVVQDAQVEAVAEVEVEADVEEEDVKEVLAEEECPALGTQERLSRGGDAKSPVLQEKGL
QASRAPATPRDEDLEEEEEEEEDEDEDDLLTAGCQELVTFEDVAVYFSLEEWERLEADQR
GLYQEVMQENYGILVSLGYPIPKPDLIFRLEQGEEPWVPDSPRPEEGDIVTGVYTGAWFW
TDDIEDHEEEDDEDFLAEVAEEENEPPGLWSAAYGVGDVPGTWGPDDSDSAQTPEGWGPD
PGGLGVLADGSEAKPFLPGREPGANLLSPWAFPAAVAPPAGRPETTCDVCGKVFPHRSRL
AKHQRYHAAVKPFGCEECGKGFVYRSHLAIHQRTHTGEKPFPCPDCGKRFVYKSHLVTHR
RIHTGERPYRCAFCGAGFGRRSYLVTHQRTHTGERPYPCSHCGRSFSQSSALARHQAVHT
ADRPHCCPDCGQAFRLRADFQRHRRGGGCAEAGGDGPRREPGETAAAAGPEDTDPGPEGS
EVGEADGEAEAAAEEREEAAVAAPTPSGKVDPAPERRFLELGNGLGEGEGPSSHPLGFHF
PVHPKSWLHPDSFPILGLPDFRERLPVDGRPLPAPLGGPLSLVEGTGLACDPFGGGGAAG
GGGGLRAFGPAIGGLLAEPAPAALAEEESPWICSDCGKTFGRRAALAKHQRYHAGERPHR
CADCGKSFVYGSHLARHRRTHTGERPFPCPECGARFARGSHLAAHVRGHTGEKPFVCGVC
GAGFSRRAHLTAHGRAHTGERPYACGECGRRFGQSAALTRHQWAHAEEKPHRCPDCGKGF
GHSSDFKRHRRTHTGEKPFRCADCGRGFAQRSNLAKHRRGHTGERPFPCPECGKRFSQRS
VLVTHQRTHTGERPYACANCGRRFSQSSHLLTHMKTHRGATAAPGSGSAPAPAPKPEAAA
KGPSSAGPGERGSALLEFAGGTSFGSEHQAAFAGPSGAYREGVL
NT seq 3015 nt   +upstreamnt  +downstreamnt
atggcggcgctccacacgactcccgactccccagctgcccagctggagcgggcagaggac
gggtcagagtgcgaccctgaccaggaagaagaggaggaggaggaggaaaagggggaagag
gtgcaggaggtggaagaagaggaggaggagatagtggtggaggaggaggaggagggtgtg
gcagaggtagtgcaggatgcgcaggtggaggcggtggccgaggtggaggtggaggcggac
gtggaggaggaggatgtgaaggaggtgctggcagaggaggagtgtccggcgttggggacc
caggagcgacttagccgtggtggtgatgccaagtccccagttcttcaggaaaagggcctg
caggcctcccgggctccagccactcctagggatgaggacctggaggaggaggaagaggag
gaggaggatgaggacgaggatgatttgctgacggctgggtgtcaggagctggtgacgttt
gaagatgtggctgtgtacttctccctggaggagtgggaaaggctggaagcagaccagcgg
ggcctctaccaggaagtcatgcaggagaactatgggattctcgtgtccttgggataccca
attcccaagcccgatctgatcttccggctggaacaaggggaagaaccttgggtcccagat
agtccccgacctgaggaaggagacatcgtcactggcgtctacacaggagcctggttctgg
acggacgacatagaggaccacgaggaggaagacgacgaggacttcctggcggaggtggcc
gaggaggagaacgagcccccagggctctggtcggcggcctacggcgtgggggacgtgcct
gggacgtgggggcccgacgactcggattcggcgcagactccagaggggtggggacccgac
ccaggcggcctgggggtcctggccgacggctctgaagcgaagcctttcctgcccggccgg
gagccgggtgcgaacctgctgtcgccctgggcgttccccgccgcagtggccccgccggcc
gggaggccggagaccacgtgcgacgtgtgcggcaaggtcttcccgcaccgctcgcggctg
gccaagcaccagcgctaccacgcggccgtcaagcccttcggctgcgaggagtgcggcaag
ggcttcgtgtaccgctcgcacttggccatccaccagcgcacgcacaccggcgagaagccc
ttcccgtgcccggactgcggcaagcgcttcgtctacaagtcgcacctggttacgcaccga
cgcatccatactggcgagcggccctaccgctgcgccttctgcggcgcgggcttcgggcgc
cgctcctacctggtcacgcaccagcgcacgcacaccggcgagcgaccctacccgtgttcg
cactgcggccgcagcttcagccagagctcggcgctggcacggcaccaggcggtgcacacg
gccgaccgcccgcactgctgtcccgactgcggccaggccttccgcctgcgcgccgacttc
cagcgccaccgacgcggcgggggctgcgcggaggcgggtggtgacggcccccggcgggag
cccggcgagacggcggccgccgcggggcccgaggacacggaccctgggccagagggatct
gaagttggcgaggcggacggagaggcggaggccgcggccgaggagagagaggaggcggcg
gtggcggcgcccacccccagcggcaaggtggaccccgcgccggaacggcgcttcctggag
ctgggcaacggcctgggggagggcgaaggcccctcctcccacccgctgggcttccacttc
cccgtgcaccccaagtcctggctgcacccggacagcttcccgatcctgggcctacccgac
ttccgagagcggctgccggtcgacgggcgcccgctcccggcgcccctggggggcccgctc
tccctggtggagggtaccgggctggcgtgcgaccctttcggcggcggcggggccgcgggc
ggcggaggcggcctgcgcgcgttcgggcccgccatcgggggtctgctggcggagcccgcg
ccggccgcgctggcggaggaggagagcccgtggatctgctcggactgcggcaagacgttt
gggcgccgggccgcgctggccaagcaccagcgctaccacgcgggcgagcggccgcatcgc
tgcgccgactgcggcaagagcttcgtgtacggctcgcacctggcgcgccaccggcgcaca
cacaccggcgagcggcccttcccgtgccccgagtgcggcgcgcggttcgcccgcggctcg
cacttggcggcgcacgtgcgcggccacacgggcgagaagccgttcgtgtgcggcgtgtgc
ggtgcggggttcagccgtcgcgcgcacttgacggcgcacgggcgcgcgcacaccggggag
cggccttacgcgtgtggagagtgcggccggcgcttcgggcagagcgcggcgctgacgcgg
catcagtgggcgcacgccgaggagaagccgcaccgctgccccgactgcggcaagggcttc
ggccacagctcggacttcaagcggcatcggcgcacgcacacgggcgagaagcccttccgc
tgcgccgactgcggccgcggcttcgcgcagcgctccaacctggccaagcaccggcgcggc
cacacgggcgaacgccccttcccgtgccctgagtgcggcaagcgcttttcgcagcgctcg
gtgctggtcacgcaccagcgcacacatacgggcgagcggccctacgcctgcgccaactgc
ggccgccgcttctcgcagagctcgcacttgctcacccacatgaagacgcaccgcggagcc
accgcagcgccgggctcgggttcggccccagcccccgcgcccaagcccgaggcggccgcc
aaggggccgtccagtgccggccccggtgagcgcggcagcgccctgctggagttcgcgggc
ggcacaagcttcggctccgagcaccaggccgcgttcgccgggccctcgggcgcctaccgg
gagggcgtcctgtga

KEGG   Homo sapiens (human): 100131827
Entry
100131827         CDS       T01001                                 
Symbol
ZNF717, OB1, X17, ZNF838
Name
(RefSeq) zinc finger protein 717
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100131827 (ZNF717)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    100131827 (ZNF717)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    100131827 (ZNF717)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 KRAB zf-C2H2_jaz Zn-ribbon_8 zf-C2H2_6
Other DBs
NCBI-GeneID: 100131827
NCBI-ProteinID: NP_001121695
OMIM: 618405
HGNC: 29448
Ensembl: ENSG00000227124
UniProt: Q9BY31
LinkDB
Position
3:complement(75694701..75785549)
AA seq 914 aa
MFPVFSGCFQELQEKNKSLELVSFEEVAVHFTWEEWQDLDDAQRTLYRDVMLETYSSLVS
LGHYITKPEMIFKLEQGAEPWIVEETPNLRLSAVQIIDDLIERSHESHDRFFWQIVITNS
NTSTQERVELGKTFNLNSNHVLNLIINNGNSSGMKPGQFNDCQNMLFPIKPGETQSGEKP
HVCDITRRSHRHHEHLTQHHKIQTLLQTFQCNEQGKTFNTEAMFFIHKRVHIVQTFGKYN
EYEKACNNSAVIVQVITQVGQPTCCRKSDFTKHQQTHTGEKPYECVECEKPSISKSDLML
QCKMPTEEKPYACNWCEKLFSYKSSLIIHQRIHTGEKPYGCNECGKTFRRKSFLTLHERT
HTGDKPYKCIECGKTFHCKSLLTLHHRTHSGEKPYQCSECGKTFSQKSYLTIHHRTHTGE
KPYACDHCEEAFSHKSRLTVHQRTHTGEKPYECNECGKPFINKSNLRLHQRTHTGEKPYE
CNECGKTFHRKSFLTIHQWTHTGEKPYECNECGKTFRCKSFLTVHQRTHAGEKPYACNEC
GKTYSHKSYLTVHHRTHTGEKPYECNECGKSFHCKSFLTIHQRTHAGKKPYECNECEKTF
INKLNLGIHKRTHTGERPYECNECGKTFRQKSNLSTHQGTHTGEKPYVCNECGKTFHRKS
FLTIHQRTHTGKNRMDVMNVEKLFVRNHTLLYIRELTPGKSPMNVMNVENPFIRRQIFRS
IKVFTRGRNPMNVANVEKPCQKSVLTVHHRTHTGEKPYECNECGKTFCHKSNLSTHQGTH
SGEKPYECDECRKTFYDKTVLTIHQRTHTGEKPFECKECRKTFSQKSKLFVHHRTHTGEK
PFRCNECRKTFSQKSGLSIHQRTHTGEKPYECKECGKTFCQKSHLSRHQQTHIGEKSDVA
EAGYVFPQNHSFFP
NT seq 2745 nt   +upstreamnt  +downstreamnt
atgtttccagtgttctctggctgtttccaagagctacaagaaaagaataaatctctggag
ttggtgtcctttgaggaggtagctgtgcacttcacctgggaggagtggcaggacctggat
gatgctcagaggaccctgtacagggacgtgatgctggagacctacagcagcctggtatca
ttggggcattacattaccaaacctgagatgatcttcaagctagagcaaggagcagagcca
tggatagtagaagaaaccccaaacctgagactttcagctgtccagatcattgatgacctt
attgaaaggagccatgaaagtcatgatagatttttctggcaaattgtaatcaccaacagc
aacacatcaactcaggagagagttgaattaggaaaaacatttaatttgaactcaaaccat
gttttaaatctgattataaataatggaaacagttcaggaatgaagcctgggcagtttaat
gattgccagaacatgcttttccctattaagcctggggagacacagtctggagagaaacct
catgtctgtgatataaccaggagatcccacagacatcatgaacatcttactcagcatcac
aagattcaaactctgctgcagacttttcaatgtaatgaacaagggaaaaccttcaacacg
gaggcaatgttctttatacataagagggttcatatagtacagacctttggtaaatataat
gaatatgagaaagcctgtaataactcagctgttattgtccaagtgataactcaggtagga
cagccaacttgctgtagaaagtctgacttcactaaacatcagcagacacacacaggagag
aaaccctatgaatgtgttgaatgtgagaaaccctccattagcaaatcagaccttatgcta
cagtgcaagatgcctactgaggaaaaaccttatgcctgtaactggtgtgaaaaattgttc
agctataagtccagcctcattatccatcagagaattcacacaggggaaaagccctatgga
tgcaatgaatgtggtaaaacctttcgccgtaagtcattcctcactttacatgagagaact
cacacaggggataaaccctacaaatgtattgaatgtggaaaaacttttcactgtaagtca
cttctcactttacatcacagaactcactcaggggaaaagccctatcagtgtagtgaatgt
ggaaaaacctttagccagaagtcatacctcacaatacatcatagaactcacacaggggaa
aagccctatgcatgtgaccattgtgaagaagcatttagccataagtcaaggcttactgtc
catcagagaacacacacaggggaaaaaccgtatgaatgtaatgagtgtggaaaacccttt
atcaataagtcaaacctcaggttacatcagagaactcacacaggggaaaaaccctatgaa
tgcaatgaatgtgggaaaacgtttcaccgtaagtcattcctcactatccatcaatggact
cacacaggggaaaaaccctacgaatgcaatgaatgtgggaaaacctttcgctgtaagtca
ttcctcactgtccatcagagaactcatgctggggaaaaaccatacgcatgtaacgaatgt
ggaaaaacatatagccacaagtcataccttacagtacatcacagaactcacacaggggaa
aaaccctatgaatgtaatgaatgtggaaaatcctttcactgtaagtcattcctaactata
catcagagaactcatgctggcaaaaaaccctatgaatgtaatgaatgtgagaaaaccttt
atcaataagttaaaccttgggatacacaagagaactcacacaggggaaagaccctatgaa
tgtaatgaatgtggaaaaacctttcgtcagaagtcaaatctcagcacccatcagggaact
cacacaggagagaaaccttacgtatgtaatgaatgtggaaaaacctttcatcgcaagtca
ttcctcaccatacaccagagaactcacacggggaaaaaccgtatggatgtaatgaatgtg
gaaaaactttttgtcagaaatcataccttattatacatcagagaactcacaccggggaaa
agccctatgaatgtaatgaatgtggaaaatcctttcatcagaaggcaaatcttcagaagc
atcaaggtattcacacgggggagaaaccctatgaatgtagcaaatgtggaaaaaccttgt
cagaagtcagtcctcactgtacatcatagaacccataccggagaaaaaccttatgaatgt
aatgagtgtgggaaaaccttttgtcacaagtcaaacctcagtacgcatcaggggactcac
tcaggagagaaaccctatgaatgtgatgaatgtaggaaaactttttacgataagacagtt
ctcaccatacatcagagaactcacacaggtgagaagccatttgaatgtaaagaatgtagg
aaaaccttctcccagaagtcaaaactctttgtacatcacagaactcacacaggggaaaaa
ccctttagatgtaatgaatgtaggaaaactttctcccagaagtcaggcctcagtatacat
cagagaacacacacaggagaaaaaccttatgaatgtaaggaatgtgggaaaaccttttgc
cagaagtcacacctcagcaggcatcaacaaacccatataggagagaaatctgacgtagct
gaggcaggctatgtgttccctcaaaatcactcttttttcccttga

KEGG   Homo sapiens (human): 100287226
Entry
100287226         CDS       T01001                                 
Symbol
ZNF729
Name
(RefSeq) zinc finger protein 729
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100287226 (ZNF729)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    100287226 (ZNF729)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    100287226 (ZNF729)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_6 XPA_N Zn-ribbon_8 zf-C2H2_jaz KRAB zf_UBZ zf-C2H2_11 C1_1 zf-C2H2_8 Zn_ribbon_SprT
Other DBs
NCBI-GeneID: 100287226
NCBI-ProteinID: NP_001229609
HGNC: 32464
Ensembl: ENSG00000196350
Pharos: A6NN14(Tdark)
UniProt: A6NN14
LinkDB
Position
19:22286441..22317176
AA seq 1252 aa
MPGAPGSLEMGPLTFRDVTIEFSLEEWQCLDTVQQNLYRDVMLENYRNLVFLGMAVFKPD
LITCLKQGKEPWNMKRHEMVTKPPVMRSHFTQDLWPDQSTKDSFQEVILRTYARCGHKNL
RLRKDCKSANEGKMHKEGYNKLNQCRTATQRKIFQCNKHMKVFHKYSNRNKVRHTKKKTF
KCIKCSKSFFMLSCLIRHKRIHIRQNIYKCEERGKAFKSFSTLTKHKIIHTEDKPYKYKK
CGNAFKFSSTFTKHKRIHTGETPFRCEECGKAFNQSSNLTDHKRIHTGEKTYKCEECGKA
FKGSSNFNAHKVIHTAEKPYKCEDCGKTFNHFSALRKHKIIHTGKKPYKREECGKAFSQS
STLRKHEIIHTGEKPYKCEECGKAFKWSSKLTVHKVVHTGEKPYKCEECGKAFSQFSTLK
KHKIIHTGKKPYKCEECGKAFNSSSTLMKHKIIHTGEKPYKCEECGKAFRQSSHLTRHKA
IHTGEKPYKCEECGKAFNHFSDLRRHKIIHTGKKPYKCEECGKAFSQSSTLRNHQIIHTG
EKPYKCEECGKAFKWSSKLTVHKVIHTGEKPCKCEECGKAFKHFSALRKHKVIHTREKLY
KCEECGKAFNNSSILAKHKIIHTGKKPYKCEECGKAFRQSSHLTRHKAIHTGEKPYKCEE
CGKAFSHFSALRRHKIIHTGKKPYKCEECGKAFSHFSALRRHKIIHTGEKPYKCEECGKA
FKWSSKLTVHKVIHTAEKPCKCEECGKSFKHFSALRKHKVIHTREKLYKCEECVKAFNSF
SALMKHKVIHTGEKPYKCEECGKAFKWSSKLTVHKVIHTGEKPCKCEECGKAFKHFSALR
KHKVIHTGKKPYKCEECGKAFSQSSSLRKHEIIHSGEKPYKCEECGKAFKWLSKLTVHKV
IHTAEKPCKCEECGKAFKHFSALRKHKIIHTGKKPYKCEECGKAFNDSSTLMKHKIIHTG
KKPYKCAECGKAFKQSSHLTRHKAIHTGEKPYKCEECGKDFNNSSTLKKHKLIHTREKLY
KCEECVKAFNNFSALMKHKIIHTGEKPYKCEECGKAFKWSSKLTEHKVIHTGEKPCKCEE
CDKAFKHFSALRKHKVIHTGKKPYQCDECGKAFNNSSTLTKHKIIHTGEKPYKCEECGKA
FSQSSILTKHKIIHSVEKPYKCEECGKAFNQSSHLTRHKTIHTGEKPYKCEECGKAFIQC
SYLIRHKTIHTREKPTNVKKVPKLLSNPHTLLDKTIHTGEKPYKCEECAKAF
NT seq 3759 nt   +upstreamnt  +downstreamnt
atgccaggtgcccctggcagcctagaaatgggaccattgacatttagagatgtgaccata
gaattctctctggaggagtggcaatgcctggacacggttcagcagaatttatatagggat
gtgatgttagagaactacagaaacctggtcttcctgggtatggctgtctttaagccagac
ttgataacttgtctgaagcaagggaaagagccttggaatatgaagagacatgagatggta
actaaacccccagttatgcgttctcattttacacaagacctttggccagatcagagcaca
aaagattctttccaagaagtaatactgagaacatatgcaagatgtggacataagaattta
cgattaagaaaagattgtaaaagtgccaatgagggtaagatgcacaaagaaggttataat
aaacttaaccaatgcaggacagctacccagagaaaaatatttcagtgtaacaaacatatg
aaagtctttcataaatattcaaatagaaataaggttagacacactaaaaagaaaactttc
aaatgtataaaatgtagcaaatcatttttcatgctttcatgcttaattcgacataagaga
attcatattagacagaatatctacaaatgtgaagaacgtggcaaagcctttaaatcgttc
tcaacccttactaaacataagataattcatactgaagacaaaccttacaaatataagaaa
tgtggcaatgcctttaaattttcttcaacgttcactaaacataagagaattcatactgga
gagacacctttcagatgtgaagaatgtggcaaagcttttaaccagtcctcaaatcttact
gaccataagagaattcatactggagagaaaacctacaaatgtgaagaatgtggcaaagct
tttaaggggtcctcaaattttaatgcacataaggtaattcatactgcagagaaaccctac
aaatgtgaagattgtggcaaaacttttaaccatttctcagcccttagaaaacataagata
attcatactggaaagaaaccctacaagcgtgaagaatgtggcaaagcttttagccagtcc
tcaacccttagaaaacatgagataattcatactggagagaaaccctacaaatgtgaagaa
tgtggtaaagcttttaagtggtcttcaaaacttactgtacataaggtagttcatactgga
gagaaaccctacaaatgtgaagaatgtggcaaagcttttagccagttctcaacccttaaa
aaacataagataattcatactggaaagaaaccctacaaatgtgaagaatgtggcaaagct
tttaacagttcctcaacccttatgaaacataagataattcatactggggagaaaccatac
aaatgtgaagaatgtggcaaagcttttaggcaatcctcacaccttactagacataaagca
attcatactggagagaaaccctacaaatgtgaagaatgtggcaaagcttttaaccatttc
tcagaccttagaagacataagataattcatactggaaagaaaccctacaaatgtgaagaa
tgtgggaaagcttttagccagtcctcaacccttagaaaccatcagataattcatactgga
gagaaaccctacaaatgtgaagaatgtggtaaagcttttaagtggtcatcaaaacttact
gtacataaggtaattcatactggagagaaaccctgcaaatgtgaagaatgtggcaaagct
tttaagcatttctcagccctcagaaaacataaggtaattcatactagggagaaattgtac
aaatgtgaagaatgtggcaaagcttttaacaattcctcaatccttgctaaacataagata
attcatactgggaagaaaccgtacaaatgtgaagaatgtggcaaagcttttaggcaatcc
tcacaccttactagacataaagcaattcatactggagagaaaccttacaaatgtgaagaa
tgtggcaaagcttttagccatttctcagcccttagaagacataagataattcatactgga
aagaaaccgtacaaatgtgaagaatgtggcaaagcttttagccatttctcagcccttaga
agacataagataattcatactggagagaaaccctacaaatgtgaagaatgtggtaaagct
tttaagtggtcatcaaaacttactgtacataaggtaattcatactgcagagaaaccctgc
aaatgtgaagaatgtggcaaatcttttaagcatttctcagcccttagaaaacataaggta
attcatactagggagaaattgtacaaatgtgaagaatgtgtcaaagcttttaacagtttc
tcagcccttatgaaacataaggtaattcatactggagagaaaccctacaagtgtgaagaa
tgtggtaaagcttttaagtggtcctcaaagcttactgtacataaggtaattcatactgga
gagaaaccctgcaaatgtgaagaatgtggcaaagcttttaagcatttctcagcccttaga
aaacataaggtaattcatactggaaagaaaccctacaaatgtgaagaatgtggcaaagct
tttagccaatcctcatcccttagaaaacatgagataattcatagtggagagaaaccatac
aaatgtgaagaatgtggtaaagcttttaagtggttgtcaaaacttactgtacataaggta
attcatactgcagagaaaccctgtaaatgtgaagaatgtggcaaagcttttaagcatttc
tcagcccttagaaaacataagataattcatactggaaagaaaccctacaaatgtgaagaa
tgtggcaaagcttttaatgattcctcaacccttatgaagcataagataattcatactggg
aagaaaccatacaaatgtgcagaatgtggcaaagcttttaagcaatcctcacatcttact
agacataaagcaattcatactggggagaaaccctacaaatgcgaagaatgtggcaaagat
tttaacaattcctcaacccttaagaaacataagctaattcatactagggagaaattgtac
aaatgtgaagaatgtgtcaaagcttttaacaatttctcagcccttatgaaacataagata
attcatactggggagaaaccctacaaatgtgaagaatgtggtaaagcttttaagtggtcc
tcaaaacttactgaacataaggtaattcatactggagagaaaccctgcaaatgtgaagaa
tgtgacaaagcttttaagcatttctcagcccttagaaaacataaggtaattcatactgga
aagaaaccctaccaatgtgacgaatgtggcaaagcttttaacaattcctcaacccttacg
aaacataagataattcatactggggagaaaccctacaaatgtgaagaatgtggcaaagcc
tttagtcagtcctcaatccttactaaacataagataattcattctgtagagaaaccctac
aaatgtgaagaatgtggcaaagcctttaaccagtcctcacaccttactagacacaaaaca
attcatactggagagaaaccctacaaatgtgaagaatgtggcaaagcttttattcagtgc
tcataccttattagacataaaacaattcataccagagagaaacctacaaatgtgaagaaa
gtaccaaagcttttaagcaatcctcacaccttactagacaaaacaattcatactggagag
aaaccctacaaatgtgaagaatgtgccaaagctttttaa

KEGG   Homo sapiens (human): 100289635
Entry
100289635         CDS       T01001                                 
Symbol
ZNF605
Name
(RefSeq) zinc finger protein 605
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100289635 (ZNF605)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    100289635 (ZNF605)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    100289635 (ZNF605)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 KRAB Zn-ribbon_8 zf-C2H2_6 zf-C2H2_jaz zinc_ribbon_15 Zn_ribbon_recom C1_4 Zn_ribbon_SprT
Other DBs
NCBI-GeneID: 100289635
NCBI-ProteinID: NP_899061
HGNC: 28068
Ensembl: ENSG00000196458
Pharos: Q86T29(Tdark)
UniProt: Q86T29
LinkDB
Position
12:complement(132918306..132956306)
AA seq 641 aa
MIQSQISFEDVAVDFTLEEWQLLNPTQKNLYRDVMLENYSNLVFLEVWLDNPKMWLRDNQ
DNLKSMERGHKYDVFGKIFNSSINIVHVGLRSHKCGTGEKSLKCPFDLLIPKNNCERKKI
DELNKKLLFCIKPGRTHGGIKYCDCSTCRKSSNEEPWLTANHITHTGVYLCMECGRFFNK
KSQLVIHQRTHTGEKPYQCSECGKAFSQKSLLTVHQRTHSGEKPHGCSECQKAFSRKSLL
ILHQRIHTGEKPYGCSECGKAFSRKSQLKRHQITHTIEKPYSCSECGKAFSQKLKLITHQ
RAHTGEKPYPCSHCGKAFFWKSQLITHQRTHTGKKPYGCGECQKAFSRNSLLIRHQRIHT
GEKPYECNECGEAFIRKPQLIKHQITHTGEKNYRCSDCEEAFFKKSELIRHQKIHLGEKP
YGCIQCGKTFFGKSQLLTHHRTHTGEKPYECSECGKAFTQKSSLISHQRTHTGEKPYECS
ECRKTFSEKSSLIHHQRTHTGEKPFECSECRKAFAWKPQLLRHQRIHTGEKPYECSECGK
AFVQKVQLIKHQRNHTGEKTYGCSDCAKAFFEKAQLIIHQRIHTGERPYKCGECGKSFTR
KSHLMRHQRIHTGDKYYGCNECGTTFNRKSQLMIHQRNHII
NT seq 1926 nt   +upstreamnt  +downstreamnt
atgatccagtcacagatatcatttgaggatgtggctgtggatttcacgctggaggaatgg
cagctacttaatcctactcagaagaacttgtacagagatgtgatgttggagaactatagc
aatctggttttcttggaagtctggctagataatcccaaaatgtggctccgagataatcaa
gacaaccttaaaagtatggagagaggccataaatatgatgtttttggaaaaatatttaat
tcaagcataaacattgttcatgtaggactgcgatcccataaatgtggcacaggagaaaaa
agtttgaaatgtccttttgatttgcttattccaaaaaataattgtgaaagaaagaaaatt
gatgaactcaataagaaattattgttctgtatcaaacctggcagaacccatggtgggata
aaatactgtgattgcagtacatgtagaaaatccagcaacgaagagccatggctcactgct
aatcacataacacacacaggagtctatttatgcatggaatgtggcagattttttaacaag
aagtcacaacttgttatacaccagagaactcatacaggagagaagccctatcaatgcagt
gagtgtggaaaagccttttcacagaagtcactgctcacggttcatcaaagaactcactca
ggagaaaaaccgcatgggtgcagcgaatgtcagaaagcttttagtaggaagtcactcctc
attttacatcagagaattcatactggagagaagccgtatggatgcagtgaatgtggaaaa
gccttcagtaggaagtcgcagcttaaaagacatcagataacgcacacaatagagaaaccc
tacagttgcagtgagtgtgggaaagcattctcccagaaattaaaactcatcacacatcag
agagcgcacacaggagagaaaccctatccatgtagtcactgtggaaaagccttcttttgg
aagtcgcagctgattactcatcagaggacccacacagggaagaaaccttacggatgtggt
gagtgtcaaaaagccttcagcaggaactcacttctcattaggcatcagaggattcataca
ggagagaagccctacgaatgcaacgaatgtggtgaagccttcatcagaaaaccacagctg
attaaacatcagataactcacacaggagagaagaactatcgatgcagtgattgtgaggag
gccttctttaagaagtcagagttaataagacatcaaaaaattcacttaggagagaaacca
tatggatgcattcaatgtgggaaaaccttctttgggaagtcccagctcctaacgcatcac
agaacacacactggggagaagccttatgaatgcagtgagtgtgggaaggccttcacccag
aagtcaagcctgatatcacatcagagaacacatacaggtgagaaaccctatgaatgcagt
gaatgcaggaaaaccttcagtgagaagtcaagtctcattcatcatcagagaacccatact
ggagaaaagccctttgaatgtagtgaatgtaggaaagcttttgcctggaagccacagctt
cttaggcatcagagaattcatacaggggagaaaccctatgaatgcagtgaatgtgggaaa
gcatttgttcagaaagtgcagctcattaagcatcaaagaaatcacacaggagagaaaacc
tatggatgcagcgattgtgcaaaagctttctttgagaaggcacagctgattatacatcag
agaattcatacaggagagagaccatataaatgtggtgaatgtgggaaatctttcacaaga
aagtcacaccttatgaggcatcagaggattcatacaggagataaatactatggatgcaat
gagtgtgggaccaccttcaacaggaagtcgcagcttatgatacatcagagaaatcatata
atataa

KEGG   Homo sapiens (human): 100289678
Entry
100289678         CDS       T01001                                 
Symbol
ZNF783
Name
(RefSeq) zinc finger protein 783
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100289678 (ZNF783)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    100289678 (ZNF783)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    100289678 (ZNF783)
SSDB
Motif
Pfam: zf-C2H2 KRAB zf-H2C2_2 zf-C2H2_4 CpXC HVO_2753_ZBP zf-Di19 DZR DUF3268 Keratin TerY_C
Other DBs
NCBI-GeneID: 100289678
NCBI-ProteinID: NP_001182149
HGNC: 27222
Ensembl: ENSG00000204946
Pharos: Q6ZMS7(Tdark)
UniProt: Q6ZMS7
LinkDB
Position
7:149262196..149284994
AA seq 546 aa
MAEAAPARDPETDKHTEDQSPSTPLPQPAAEKNSYLYSTEITLWTVVAAIQALEKKVDSC
LTRLLTLEGRTGTAEKKLADCEKTAVEFGNQLEGKWAVLGTLLQEYGLLQRRLENVENLL
RNRNFWILRLPPGSKGEAPKVPVTFDDVAVYFSELEWGKLEDWQKELYKHVMRGNYETLV
SLDYAISKPDILTRIERGEEPCLDRWGQEKGNEVEVGRPRMMGTGLPPYPEHLTSPLSPA
QEELKEGQAPKQQQDSEARVAPAGPEAGGGVAIKTEAQSEDEMTPERLFLGVSRGQTECR
IPRGPRNRPGGPSRHQAQGMPRVRAGEPRPPGASGETPRVLSRRRQRAFPCPDCGQSFRL
KINLTIHQRTHVEEGRQEAPGRSPTSCGDSQAMLEPGEVVVPGPVIRWLPEEPEGRRSVA
GGRALVGRRPAASKMYHCSECLRFFQQRKSLLLHQRLHTGNGQGWPACPYCGKAFRRPSD
LFRHQRIHTGERPYQCPQCGRTFNRNHHLAVHMQTHARGQVGPHFPAAPARHGSLPLPWP
SRKEEG
NT seq 1641 nt   +upstreamnt  +downstreamnt
atggccgaagcggcgcctgcccgggaccccgagacagacaagcacacagaggaccagagt
ccttcgacacccttgccccagccagctgctgagaagaactcgtacctctactccacggaa
atcacactgtggacggtggtggccgccattcaggccttggagaagaaggtggattcctgc
ctgacccgcttgctgactctggaggggcgcacggggacagccgagaagaagctggccgac
tgcgagaagacagctgtggagttcgggaaccagctggagggcaagtgggccgtgctgggg
accttgctgcaggagtacgggctgctgcagaggcggctggagaatgtggagaacttgctg
cgcaacaggaacttctggatcttgcggctgcccccgggcagcaagggggaggcccccaag
gtgcccgtgaccttcgatgatgtggccgtgtatttctctgagctggagtggggcaagctg
gaggactggcagaaggagctctacaagcacgtgatgaggggcaactacgagacgctggtc
tccctggattatgcaatctccaaaccagacatcctcacccggatagagaggggagaggag
ccttgtcttgaccggtggggccaggagaaggggaatgaagtagaggtgggacgtccaagg
atgatgggcactggcctccctccgtatccagagcacctcaccagcccacttagccctgcc
caggaggagctgaaagaagggcaggcccccaagcagcagcaggactcagaggcgagagtg
gccccagccgggccagaagcaggtggtggtgtggccatcaagacagaggcacagtctgaa
gacgagatgacgcctgagcggctctttctgggggtgtcccgaggccagaccgagtgtaga
atcccccgagggcccaggaacaggcctgggggccccagccgtcatcaggcccagggcatg
cccagggtgcgggcaggggagccacggccaccgggggccagtggggagacgccccgagtc
ctctcccgcaggcggcagcgggcattcccctgccccgactgcgggcagagcttccgcctg
aagatcaatctgacgattcatcagcggacccatgtggaggaggggcggcaggaggccccc
ggccgctcgcccaccagctgcggggacagccaggccatgctggagccgggggaggtggtg
gtacccggccctgtcatccgctggctccccgaggagcctgagggtcgccgctccgtggca
gggggccgtgccttggtggggcggcggcctgcagccagcaagatgtaccactgcagcgag
tgcctgcgcttcttccagcagcgcaagagcctgctgctgcaccagcgcctgcacaccggc
aatggccagggctggcccgcctgcccctactgcggcaaggccttccgccggccctcggac
ctcttccggcaccagcgcatccacaccggtgagcggccctaccagtgcccccagtgtggc
cggaccttcaaccgcaaccaccacctggccgtgcacatgcagacccacgcccgaggccag
gtgggcccacacttccctgccgcccccgcccgccacgggagcctgcccctgccctggccc
agccggaaggaggagggctga

KEGG   Homo sapiens (human): 100529215
Entry
100529215         CDS       T01001                                 
Symbol
ZNF559-ZNF177
Name
(RefSeq) ZNF559-ZNF177 readthrough
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100529215 (ZNF559-ZNF177)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    100529215 (ZNF559-ZNF177)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    100529215 (ZNF559-ZNF177)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 KRAB zf-C2H2_6 zf-C2H2_jaz zf-C2H2_11 zf_UBZ C1_1 Zn-ribbon_8 Zn_ribbon_SprT zf-met zinc_ribbon_15 zf-LYAR HVO_2753_ZBP C1_4 DUF5830
Other DBs
NCBI-GeneID: 100529215
NCBI-ProteinID: NP_001166121
HGNC: 42964
Ensembl: ENSG00000270011
UniProt: Q13360
LinkDB
Position
19:9324179..9382617
AA seq 321 aa
MAAGWLTTWSQNSVTFQEVAVDFSQEEWALLDPAQKNLYKDVMLENFRNLASVGYQLCRH
SLISKVDQEQLKTDERGILQGDCADWETQLKPKDTIAMQNIPGGKTSNGINTNCVRTHSG
EMPYECSDCGKAFIFQSSLKKHMRSHTGEKPYECDHCGKSFSQSSHLNVHKRTHTGEKPY
DCKECGKAFTVPSSLQKHVRTHTGEKPYECSDCGKAFIDQSSLKKHTRSHTGEKPYECNQ
CGKSFSTGSYLIVHKRTHTGEKTYECKECGKAFRNSSCLRVHVRTHTGEKPYKCIQCEKA
FSTSTNLIMHKRIHNGQKLHE
NT seq 966 nt   +upstreamnt  +downstreamnt
atggctgcagggtggctgacaacctggtcacagaactcagtaaccttccaggaagtggca
gtggacttttcccaggaggagtgggcattgctggaccctgctcaaaaaaatctatacaaa
gatgtgatgctggagaactttaggaacctggcctcagtagggtatcagctctgcagacac
agtctgatctccaaggtggatcaagaacagctgaagacagatgaaagaggaattttacaa
ggtgactgtgcagactgggaaactcaacttaaaccaaaagatacaattgctatgcagaac
attcctgggggaaaaacatccaatggcataaacacgaactgtgtcagaactcactctgga
gagatgccctatgaatgcagtgactgtgggaaagccttcatttttcagtcttcccttaag
aaacacatgagatctcatactggagagaagccttatgagtgtgatcactgtggaaaatcc
tttagccagagctctcatctgaatgtgcacaaaagaactcacactggagagaaaccctat
gactgtaaggaatgtgggaaggctttcactgttccttcatcccttcagaaacatgtgaga
acccacactggagagaaaccctatgaatgcagtgactgtggaaaagccttcatcgatcag
tcatcccttaagaaacacacacgctctcacactggagagaagccttatgagtgtaaccag
tgtggaaagtccttcagcacaggctcttaccttattgtgcacaagagaactcacactggt
gagaaaacctatgagtgtaaagaatgtgggaaggcctttaggaattcctcttgcctgagg
gtacacgtgagaactcacactggagagaagccttataaatgtattcagtgtgaaaaagcc
tttagcacaagcactaaccttataatgcacaagcgaatccacaatggccagaaactccat
gaatga

KEGG   Homo sapiens (human): 101060200
Entry
101060200         CDS       T01001                                 
Symbol
ZNF891
Name
(RefSeq) zinc finger protein 891
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    101060200 (ZNF891)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    101060200 (ZNF891)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    101060200 (ZNF891)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 KRAB zf-C2H2_6 zf-C2H2_jaz zf-C2H2_11 Zn-ribbon_8 zf-LYAR zf-met zinc_ribbon_15 zf-BED zf-C2HE C1_4 TRAF6_Z2 zf-H2C2_5
Other DBs
NCBI-GeneID: 101060200
NCBI-ProteinID: NP_001264220
HGNC: 38709
Ensembl: ENSG00000214029
Pharos: A8MT65(Tdark)
UniProt: A8MT65
LinkDB
Position
12:complement(133104779..133130274)
AA seq 544 aa
MAVMDLSSPWALTKQDSACFHLRNAEEERMIAVFLTTWLQEPMTFKDVAVEFTQEEWMML
DSAQRSLYRDVMLENYRNLTSVEYQLYRLTVISPLDQEEIRNMKKRIPQAICPDQKIQPK
TKESTVQKILWEEPSNAVKMIKLTMHNWSSTLREDWECHKIRKQHKIPGGHWRQMIYAPK
KTVPQELFRDYHELEENSKLGSKLIFSQSIFTSKHCQKCYSEIGCLKHNSIINNYVKNSI
SEKLYESHECDTTLWHFQRNQTVQKEYTYSKHGMHFTHNMFPVPNNLHMAQNACECNKDE
TLCHQSSLKKQGQTHTEKKHECNQCGKAFKRISNLTLYKKSHMGEKQYECKECGKVFNDS
STLRRHVRTHTGEKPYECNQCGKAFSQKTSLKAHMRTHTGEKPYECNQCGKSFGTSSYLI
VHKRIHTGEKLYECSECGKAFNTSSHLKVHKKIHTGENVYECSDCGKVFSGVSSLRMHIR
THTGEKPYECKECRKAFSVSSSLRRHVRIHTGEKPYECIQCGKAFSQSSSLIIHKRIHTE
RETL
NT seq 1635 nt   +upstreamnt  +downstreamnt
atggcagttatggacctatcctccccatgggctttaactaaacaggactctgcctgtttc
catctgagaaatgctgaagaggaaaggatgattgctgtatttctgacaacctggttacag
gaaccaatgactttcaaagatgtagctgtggagttcactcaggaggagtggatgatgctg
gattctgctcaaagaagtctgtacagagatgtgatgttggaaaactatagaaatctcacc
tccgtggaatatcagttgtacaggcttactgtgatctccccattggatcaagaagagata
aggaatatgaaaaagagaattccccaagccatctgtccagaccagaagattcaacctaaa
accaaagaatcaactgtgcagaaaattttgtgggaggaaccatccaatgcagtgaaaatg
ataaaactcacaatgcataattggtcctccacattaagagaagactgggaatgccataag
atcagaaaacagcataagattccagggggacattggaggcaaatgatatatgccccaaag
aaaacagtacctcaggagctattccgtgactatcatgaattagaggaaaactctaaactt
ggatcaaaacttattttttcacagagcattttcaccagtaaacattgccaaaaatgttac
tcagagattggatgtttgaaacacaattcaatcataaacaattatgtgaaaaactctata
agtgagaagctctatgaaagtcatgaatgtgatacaactctatggcattttcagagaaat
caaacagtacaaaaagagtacacatattctaaacatggaatgcacttcacacataatatg
tttcctgtacctaacaatttgcatatggcacagaatgcctgtgaatgtaataaagatgaa
acgctgtgtcatcaatcatcccttaagaaacaaggacaaactcatactgaaaagaaacat
gaatgcaatcaatgtggaaaagccttcaaaaggatttctaatcttactttatacaagaaa
agtcacatgggtgagaaacaatatgaatgtaaagaatgtggtaaagtgttcaatgattcc
tcaaccttaaggagacatgtaagaactcacactggagagaaaccctatgaatgtaatcaa
tgtggaaaagctttcagtcaaaaaacatcccttaaggctcacatgagaactcacactgga
gagaaaccttatgaatgtaatcagtgtggaaaatcctttggcacaagctcttaccttata
gtgcacaagagaatacacactggagaaaaactctatgaatgcagtgagtgtggaaaagcc
ttcaacacgagctctcaccttaaagttcataagaaaattcataccggagagaatgtttat
gaatgcagtgactgtgggaaagttttcagtggggtctcatcccttagaatgcatataaga
actcacactggagagaaaccctatgaatgtaaggaatgtaggaaagccttcagtgtttcc
tcttcccttaggaggcatgtgagaattcacactggagagaaaccctatgaatgtattcaa
tgtggaaaagccttcagtcagagctcttcacttattatacacaagagaattcatactgag
agagaaaccctgtaa

KEGG   Homo sapiens (human): 10172
Entry
10172             CDS       T01001                                 
Symbol
ZNF256, BMZF-3, BMZF3
Name
(RefSeq) zinc finger protein 256
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    10172 (ZNF256)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    10172 (ZNF256)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    10172 (ZNF256)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_6 KRAB zf-C2H2_jaz zf_UBZ zinc_ribbon_15 C1_1 Zn-ribbon_8 zf-C2H2_11 C1_4
Other DBs
NCBI-GeneID: 10172
NCBI-ProteinID: NP_005764
OMIM: 606956
HGNC: 13049
Ensembl: ENSG00000152454
Pharos: Q9Y2P7(Tdark)
UniProt: Q9Y2P7
LinkDB
Position
19:complement(57940833..57947706)
AA seq 627 aa
MAAAELTAPAQGIVTFEDVAVYFSWKEWGLLDEAQKCLYHDVMLENLTLTTSLGGSGAGD
EEAPYQQSTSPQRVSQVRIPKALPSPQKTNPCEICGPVLRQILHLVEHQGTHHGQKLYTD
GACRKQLQFTAYLHQHQKQHVGQKHFRSNGGRDMFLSSCTFEVSGKPFTCKEVGKDFLVR
SRFLQQQAAHTRKKSNRTKSAVAFHSVKNHYNWGECVKAFSYKHVRVQHQGDLIRERSYM
CSECGKSFSTSCSLSDHLRVHTSEKPYTCGECGKSYRQSSSLITHRRIHTGVRPHQCDEC
GKLFNRKYDLLIHQRVHTGERPYKCSECGKSFSHSSSLITHQRIHTGMRPYECSECGKSF
IHSSSLITHQRVHTGTRPYMCSECGKSFSQSCHLIKHRRLHIGEGPYECSECGKLFTYRS
RFFQHQRVHTGVRSHECHECGKLFSRKFDLIVHERVHTGERPYECSECGKSFTCKSYLIS
HWKVHTGARPYECGECGKSFTHSSTLLQHQRVHTGERPYECNECGKFFSQSSSLIRHRRS
HTGERPYECSECWKSFSNHSSLVKHRRVHTGERPYECSECGKSFSQSSNLTNHQRIHSGE
RPYECSDCGKFFTFNSNLLKHQNVHKG
NT seq 1884 nt   +upstreamnt  +downstreamnt
atggcggcggccgagctgacggccccggcccagggcattgtgacctttgaggacgtggct
gtttacttctcctggaaggagtggggtcttcttgatgaggctcagaaatgcctgtaccac
gatgtgatgctggagaacttgacacttacaacctccctgggtggttctggagcaggggat
gaggaggcaccttatcagcagagcacttctccacagcgggtgtcacaggttaggattcct
aaggcccttccttctccccagaagaccaacccctgtgagatatgtggcccagtcttgaga
cagattttgcacttggttgaacaccaaggaacacaccatggtcagaaactgtatacagac
ggggcatgtaggaaacaattacaatttactgcataccttcatcagcaccagaagcagcat
gttggacagaaacacttcagaagcaatgggggcagagacatgtttttgagcagctgcaca
tttgaagtatctgggaagcccttcacttgcaaggaggttgggaaggatttcctggtgaga
tcaagatttcttcagcaacaggctgctcacaccagaaagaagtcaaacagaaccaagagt
gcagtggcctttcacagtgtaaaaaatcattacaactggggagaatgtgtgaaagctttc
agctacaaacatgtacgtgttcagcaccagggagacctcattagggaaagatcttacatg
tgcagtgaatgtgggaaatcttttagcacaagctgtagcctcagtgatcatttgagagtt
cacacttcagaaaagccttatacatgtggagaatgtgggaaatcctataggcaaagctct
agccttattacgcaccgaagaattcacactggagtaagacctcatcaatgtgatgaatgt
ggaaaattatttaacaggaagtatgaccttcttatacatcagagagttcatactggagaa
aggccttacaagtgcagtgaatgtgggaaatcctttagccatagctctagcctcattaca
caccagagaattcatactggaatgaggccttatgagtgcagtgaatgtgggaaatctttt
atccatagttctagccttattacacaccagagagttcacactggtacaaggccttatatg
tgcagtgaatgtgggaaatcctttagccagagctgtcacctcattaaacaccggagactt
cacattggagaagggccttatgagtgtagtgaatgtgggaaattgtttacttatagatct
cgtttcttccaacaccagagagttcatactggagtaagatctcatgaatgtcatgaatgt
ggaaaattatttagcaggaaatttgacctcattgtacatgagagagttcacacaggagaa
aggccatatgagtgcagtgaatgtggaaaatcctttacctgtaaatcctacctcatctca
cactggaaagttcatactggagcaaggccttatgaatgtggggagtgtgggaaatcattt
actcatagctctacgctccttcaacaccagagagttcacactggagaaaggccttatgag
tgcaatgaatgtgggaagttttttagccagagctccagcctcattagacataggagaagt
cacaccggagaaaggccttatgagtgcagtgagtgttggaaatcctttagtaaccactct
agcctcgttaaacaccgaagagttcataccggagaaaggccttatgaatgcagtgaatgt
ggaaaatcctttagccagagctctaacctcactaatcaccagcgaattcacagtggggaa
aggccttatgagtgtagtgactgtggaaaattttttaccttcaactccaacctcctaaaa
catcagaacgttcacaagggataa

KEGG   Homo sapiens (human): 10224
Entry
10224             CDS       T01001                                 
Symbol
ZNF443, ZK1
Name
(RefSeq) zinc finger protein 443
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    10224 (ZNF443)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    10224 (ZNF443)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    10224 (ZNF443)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_6 KRAB zf-C2H2_jaz zf-C2H2_11 Zn-ribbon_8 Zn_ribbon_SprT zf_UBZ zf-trcl zf-met zinc_ribbon_15
Other DBs
NCBI-GeneID: 10224
NCBI-ProteinID: NP_005806
OMIM: 606697
HGNC: 20878
Ensembl: ENSG00000180855
Pharos: Q9Y2A4(Tbio)
UniProt: Q9Y2A4
LinkDB
Position
19:complement(12429706..12441021)
AA seq 671 aa
MASVALEDVAVNFTREEWALLGPCQKNLYKDVMQETIRNLDCVVMKWKDQNIEDQYRYPR
KNLRCRMLERFVESKDGTQCGETSSQIQDSIVTKNTLPGVGPCESSMRGEKVMGHSSLNC
YIRVGAGHKPHEYHECGEKPDTHKQRGKAFSYHNSFQTHERLHTGKKPYDCKECGKSFSS
LGNLQRHMAVQRGDGPYKCKLCGKAFFWPSLLHMHERTHTGEKPYECKQCSKAFSFYSSY
LRHERTHTGEKPYECKQCSKAFPFYSSYLRHERTHTGEKPYKCKQCSKAFPDSSSCLIHE
RTHTGEKPYTCKQCGKAFSVSGSLQRHETTHSAEKPYACQQCGKAFHHLGSFQRHMIRHT
GNGPHKCKICGKGFDCPSSLQSHERTHTGEKPYECKQCGKALSHRSSFRSHMIMHTGDGP
HKCKVCGKAFVYPSVFQRHERTHTAEKPYKCKQCGKAYRISSSLRRHETTHTGEKPYKCK
LGKACIDFCSFQNHKTTHTGEKPYECKECGKAFSRFRYLSRHKRTHTGEKPYECKTCRKA
FGHYDNLKVHERIHSGEKPYECKECGKAFSWLTCFLRHERIHMREKSYECPQCGKAFTHS
RFLQGHEKTHTGENPYECKECGKAFASLSSLHRHKKTHWKKTHTGENPYECKECGKAFAS
LSSLHRHKKTH
NT seq 2016 nt   +upstreamnt  +downstreamnt
atggcctcagtggctttagaggatgtggctgtgaacttcacccgagaagagtgggctttg
ctgggtccttgtcagaagaatctctacaaagatgtgatgcaggaaaccatcaggaacctg
gattgtgtagtaatgaaatggaaagaccagaacattgaagatcaatatagatatcccagg
aaaaatctaagatgtcgtatgttagagagatttgttgaaagtaaagatggaactcaatgt
ggagaaacatctagccagattcaagatagtattgtgaccaagaacactcttcctggagta
ggtccttgtgaaagcagtatgagaggagaaaaagtcatgggtcattcatcccttaattgt
tacatcagagttggtgctgggcacaaaccacatgagtatcatgaatgtggagagaagcca
gatacgcataaacaacgtgggaaagccttcagttaccacaactcatttcaaacacatgag
aggcttcacactggaaagaaaccatatgattgtaaagaatgtgggaagtccttcagttct
ttgggaaaccttcaaagacacatggcagtgcagcgtggagatggaccttataaatgtaag
ttgtgtgggaaagcgtttttttggcccagtttattacatatgcatgaaagaacgcacact
ggagagaaaccatatgaatgtaagcagtgttctaaagccttttctttttacagttcctat
ctaagacatgaaagaacacatactggggagaaaccgtatgaatgtaaacagtgttctaaa
gcctttcctttttacagttcctatctaagacatgaaagaacacatactggggagaaacca
tataaatgtaagcagtgttctaaagccttccctgattccagttcttgtctaatacatgaa
agaactcacactggagagaaaccctatacatgtaaacaatgtgggaaagccttcagtgtt
tccggttcccttcaaagacatgaaaccactcacagtgcagagaaaccctatgcatgtcag
caatgtgggaaagcgtttcatcatctgggaagctttcaaagacacatgataaggcacact
ggaaatggacctcataaatgtaagatatgtgggaaaggctttgattgtcctagttcactg
caaagtcatgaaagaactcacactggagagaaaccctatgaatgcaagcagtgtgggaaa
gcattatctcatcgctcaagctttcgaagtcatatgataatgcacactggagatggacct
cataaatgcaaggtatgtgggaaagcctttgtttatcccagtgtatttcaaagacatgaa
aggactcacactgcagagaaaccctataaatgtaaacaatgtggcaaagcctaccgtatt
tccagttcccttcgaaggcatgaaacaactcatactggagagaaaccctataaatgcaaa
cttgggaaagcctgtattgatttctgttcctttcaaaatcacaaaacaactcacactgga
gagaagccatatgagtgtaaggaatgtgggaaagcattcagtcgtttcagatacctttct
cgacataaaaggactcacacaggagagaaaccttatgagtgtaaaacatgtaggaaagcc
ttcggtcattatgataacttaaaggtacatgaaagaattcactctggagagaagccgtat
gaatgtaaggaatgtgggaaagcattctcttggctcacttgctttctacgacatgaaaga
attcacatgagagagaaatcctatgaatgtccacaatgtggtaaagccttcactcattcc
cgttttcttcaaggacatgaaaaaactcatactggagagaacccgtatgaatgtaaggaa
tgtgggaaagcatttgcttctctcagttccttgcatagacataaaaagactcactggaaa
aaaactcacactggagagaacccatatgaatgtaaggaatgtgggaaagcatttgcttct
ctcagttccttgcatagacataaaaagactcactag

KEGG   Homo sapiens (human): 10308
Entry
10308             CDS       T01001                                 
Symbol
ZNF267, HZF2
Name
(RefSeq) zinc finger protein 267
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    10308 (ZNF267)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    10308 (ZNF267)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    10308 (ZNF267)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_6 KRAB zf-C2H2_jaz zf-met XPA_N Zn-ribbon_8 C1_4
Other DBs
NCBI-GeneID: 10308
NCBI-ProteinID: NP_003405
OMIM: 604752
HGNC: 13060
Ensembl: ENSG00000185947
Pharos: Q14586(Tdark)
UniProt: Q14586
LinkDB
Position
16:31873807..31917357
AA seq 743 aa
MGLLTFRDVAVEFSLEEWEHLEPAQKNLYQDVMLENYRNLVSLGLVVSKPDLITFLEQRK
EPWNVKSEETVAIQPDVFSHYNKDLLTEHCTEASFQKVISRRHGSCDLENLHLRKRWKRE
ECEGHNGCYDEKTFKYDQFDESSVESLFHQQILSSCAKSYNFDQYRKVFTHSSLLNQQEE
IDIWGKHHIYDKTSVLFRQVSTLNSYRNVFIGEKNYHCNNSEKTLNQSSSPKNHQENYFL
EKQYKCKEFEEVFLQSMHGQEKQEQSYKCNKCVEVCTQSLKHIQHQTIHIRENSYSYNKY
DKDLSQSSNLRKQIIHNEEKPYKCEKCGDSLNHSLHLTQHQIIPTEEKPCKWKECGKVFN
LNCSLYLTKQQQIDTGENLYKCKACSKSFTRSSNLIVHQRIHTGEKPYKCKECGKAFRCS
SYLTKHKRIHTGEKPYKCKECGKAFNRSSCLTQHQTTHTGEKLYKCKVCSKSYARSSNLI
MHQRVHTGEKPYKCKECGKVFSRSSCLTQHRKIHTGENLYKCKVCAKPFTCFSNLIVHER
IHTGEKPYKCKECGKAFPYSSHLIRHHRIHTGEKPYKCKACSKSFSDSSGLTVHRRTHTG
EKPYTCKECGKAFSYSSDVIQHRRIHTGQRPYKCEECGKAFNYRSYLTTHQRSHTGERPY
KCEECGKAFNSRSYLTTHRRRHTGERPYKCDECGKAFSYRSYLTTHRRSHSGERPYKCEE
CGKAFNSRSYLIAHQRSHTREKL
NT seq 2232 nt   +upstreamnt  +downstreamnt
atgggactgttgacattcagggatgtggccgtagaattctctttggaggagtgggaacac
ctggaaccagctcagaagaatttgtatcaggatgtgatgttagaaaactacagaaacctg
gtctctctgggtcttgttgtctctaagccggacctgatcacctttttggaacaaaggaaa
gagccttggaatgtgaagagtgaggagacagtagccatccagccagatgtgttttcgcat
tataacaaggacctgttgacagagcactgcacagaagcttcattccaaaaagtgatatcg
aggagacatgggagctgtgatcttgagaatttacatttaagaaaaaggtggaaaagggag
gagtgtgaagggcacaatggatgttatgatgaaaagacttttaaatatgatcaatttgat
gaatcctctgttgaaagtttgtttcaccagcaaatactttcttcttgtgccaaaagctat
aactttgatcaatataggaaggtctttactcattcatcattgcttaatcaacaagaggaa
atagatatttggggaaaacatcacatatatgataaaacttcagtgttatttaggcaggtc
tctactctaaatagttaccgaaatgtttttattggagagaaaaattatcattgcaataat
tctgaaaaaaccttgaaccaaagctcaagccctaaaaatcatcaggaaaattattttcta
gaaaaacaatacaaatgtaaagaatttgaggaagtctttcttcagagtatgcatgggcaa
gagaaacaagaacagtcttacaaatgtaataaatgtgtagaagtttgtacccagtcatta
aaacatattcaacatcagaccatccatatcagagaaaactcatatagctataacaaatat
gataaagatcttagtcagtcatcaaatcttagaaagcagataatccataatgaagagaaa
ccatacaaatgtgaaaaatgtggggatagcttaaaccatagtttgcaccttactcaacat
cagatcattcctaccgaagagaaaccctgtaaatggaaagaatgtggcaaggtctttaac
cttaactgtagtttataccttactaaacagcagcaaattgatactggagaaaacctttac
aaatgtaaagcatgtagcaaatcttttactcgttcctccaatcttattgtgcatcagaga
attcacactggagagaaaccatacaaatgtaaagaatgtggcaaagcctttcgctgtagt
tcataccttactaaacataagcgaattcatactggagagaaaccttataaatgtaaagaa
tgtggaaaagcttttaaccgtagttcatgccttactcaacatcagacaactcatacagga
gaaaaactttacaaatgtaaagtatgtagcaaatcttatgctcgttcttcaaatcttatt
atgcatcagagagttcatactggagagaagccttataaatgtaaagaatgtggcaaagtc
tttagccgtagttcttgccttactcaacatcggaaaattcatactggagaaaatctttac
aaatgcaaagtatgtgctaaaccttttacttgtttctcaaatcttattgtgcatgagaga
attcatactggagagaaaccctataaatgtaaagaatgtggcaaagcctttccttatagt
tcacaccttattcgacatcatcgaattcatactggagaaaaaccatacaaatgtaaagca
tgtagcaaatcttttagtgactcctcaggtcttactgtgcatcggcgaactcatactgga
gagaaaccctatacatgtaaagaatgtggcaaagcctttagttatagttcagatgttatt
cagcatcggagaattcatactggccagagaccctacaaatgtgaagaatgtggcaaagcc
ttcaactataggtcatacctcactacacatcagagaagtcatactggagagagaccctac
aaatgtgaagaatgtggcaaagccttcaactctaggtcatacctcactacacatcggaga
agacatactggagagagaccctacaaatgtgatgaatgtggtaaagccttcagctatagg
tcatacctcactacacatcggagaagtcatagtggagagagaccctacaaatgtgaagaa
tgtggcaaagcctttaactctaggtcatacctcattgcacatcagagaagtcatactaga
gaaaaactttaa

KEGG   Homo sapiens (human): 10520
Entry
10520             CDS       T01001                                 
Symbol
ZNF211, C2H2-25, CH2H2-25, ZNF-25
Name
(RefSeq) zinc finger protein 211
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    10520 (ZNF211)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    10520 (ZNF211)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    10520 (ZNF211)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 KRAB zf-C2H2_6 Zn-ribbon_8 zf_UBZ zf-C2H2_jaz zf-H2C2_5 zinc_ribbon_15 DUF5830 Zn_Tnp_IS1595
Other DBs
NCBI-GeneID: 10520
NCBI-ProteinID: NP_942152
OMIM: 601856
HGNC: 13003
Ensembl: ENSG00000121417
Pharos: Q13398(Tdark)
UniProt: Q13398
LinkDB
Position
19:57633168..57644041
AA seq 564 aa
MLGFPPGRPQLPVQLRPQTRMATALRDPASGSVTFEDVAVYFSWEEWDLLDEAQKHLYFD
VMLENFALTSSLGCWCGVEHEETPSEQRISGERVPQFRTSKEGSSSQNADSCEICCLVLR
DILHLAEHQGTNCGQKLHTCGKQFYISANLQQHQRQHITEAPFRSYVDTASFTQSCIVHV
SEKPFTCREIRKDFLANMRFLHQDATQTGEKPNNSNKCAVAFYSGKSHHNWGKCSKAFSH
IDTLVQDQRILTREGLFECSKCGKACTRRCNLIQHQKVHSEERPYECNECGKFFTYYSSF
IIHQRVHTGERPYACPECGKSFSQIYSLNSHRKVHTGERPYECGECGKSFSQRSNLMQHR
RVHTGERPYECSECGKSFSQNFSLIYHQRVHTGERPHECNECGKSFSRSSSLIHHRRLHT
GERPYECSKCGKSFKQSSSFSSHRKVHTGERPYVCGECGKSFSHSSNLKNHQRVHTGERP
VECSECSKSFSCKSNLIKHLRVHTGERPYECSECGKSFSQSSSLIQHRRVHTGKRPYQCS
QCGKSFGCKSVLIQHQRVHIGEKP
NT seq 1695 nt   +upstreamnt  +downstreamnt
atgctcgggttccccccgggtcgcccgcagctcccggtccagctccgcccacagactcgg
atggcgaccgcactgagggacccggcttcgggaagtgtgacctttgaagatgtggccgtg
tacttctcctgggaggaatgggatctccttgatgaggctcagaaacacctgtacttcgat
gtgatgctggagaactttgcacttacgtcctccctgggttgttggtgtggagtggaacat
gaggaaacaccttctgaacagagaatttctggagaaagagtgccacagttcaggacttcc
aaagaaggttcatcttcccagaatgccgactcctgtgaaatatgttgcctggtcttgaga
gatattttgcacttggctgaacaccaaggaacaaactgcgggcagaaactacacacatgt
ggaaaacaattctacatcagtgcaaatcttcaacagcaccagaggcagcacattacagag
gcacctttcagaagttatgtggacactgcctcgtttacacagagttgcatagtccatgtg
tcggagaaaccctttacctgcagggagatcaggaaagacttcctggccaacatgaggttt
ctccatcaagacgccactcaaacaggggagaagccaaataacagtaacaagtgtgcggtg
gccttttacagtggaaaaagtcatcacaactggggaaaatgcagtaaagcctttagccac
atagacacacttgttcaggaccagagaatcctcactagagaaggactttttgagtgcagt
aaatgtgggaaagcatgtacgcgaagatgtaacctcattcagcaccagaaagtccacagt
gaagaaaggccttatgaatgcaatgaatgtggaaaattctttacctactactccagtttc
attatacatcagagagttcatactggagaaaggccttatgcgtgccctgaatgtgggaaa
tcgtttagtcagatatacagcctcaatagccataggaaagttcacactggagaaaggcct
tatgaatgtggggaatgtgggaaatcttttagccaaaggtccaacctcatgcagcatcgc
agagttcacactggagaaaggccttatgaatgcagcgaatgtgggaaatcttttagccaa
aactttagcctgatctaccaccagagagttcacactggagaaagacctcatgagtgcaat
gaatgtggaaaatcctttagccgaagctccagcctcattcaccaccggagacttcacact
ggagaaagaccctatgagtgcagtaaatgtgggaagtcatttaagcaaagctccagcttc
agttcacatcggaaagtccacacaggggaaaggccttatgtgtgtggggaatgtgggaaa
tcctttagccatagctccaaccttaagaaccaccagagagttcacactggagaaagacct
gttgagtgcagtgaatgtagcaaatcctttagctgtaaatctaacctcattaaacacctg
agagttcacactggagaaaggccttatgagtgcagtgaatgtgggaaatcctttagccaa
agttctagcctcattcaacaccgcagagttcacacgggaaaaaggccttatcagtgcagt
caatgtgggaaatcctttggctgcaaatctgtcctcattcaacaccagagagttcacatt
ggagaaaagccttag

KEGG   Homo sapiens (human): 10780
Entry
10780             CDS       T01001                                 
Symbol
ZNF234, HZF4, ZNF269
Name
(RefSeq) zinc finger protein 234
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    10780 (ZNF234)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    10780 (ZNF234)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    10780 (ZNF234)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_jaz KRAB Zn-ribbon_8 zf_UBZ zf-met zf-C2H2_6 C1_1 zf-trcl BolA Zn_ribbon_SprT DUF6076 HNH GAGA
Other DBs
NCBI-GeneID: 10780
NCBI-ProteinID: NP_001138296
OMIM: 604750
HGNC: 13027
Ensembl: ENSG00000263002
Pharos: Q14588(Tdark)
UniProt: Q14588 A0A024R0N3
LinkDB
Position
19:44141554..44160313
AA seq 700 aa
MTTFKEGLTFKDVAVVFTEEELGLLDPVQRNLYQDVMLENFRNLLSVGHHPFKHDVFLLE
KEKKLDIMKTATQRKGKSADKIQSEVETVPEAGRHEELYWGQIWKQIASDLIKYEDSMIS
ISRFPRQGDLSCQVRAGLYTTHTGQKFYQCDEYKKSFTDVFNFDLHQQLHSGEKSHTCDE
CGKSFCYISALHIHQRVHMGEKCYKCDVCGKEFSQSSHLQTHQRVHTVEKPFKCVECGKG
FSRRSTLTVHCKLHSGEKPYNCEECGRAFIHASHLQEHQRIHTGEKPFKCDTCGKNFRRR
SALNNHCMVHTGEKPYKCEDCGKCFTCSSNLRIHQRVHTGEKPYKCEECGKCFIQPSQFQ
AHRRIHTGEKPYVCKVCGKGFIYSSSFQAHQGVHTGEKPYKCNECGKSFRMKIHYQVHLV
VHTGEKPYKCEVCGKAFRQSSYLKIHLKAHSVQKPFKCEECGQGFNQSSRLQIHQLIHTG
EKPYKCEECGKGFSRRADLKIHCRIHTGEKPYNCEECGKVFSQASHLLTHQRVHSGEKPF
KCEECGKSFSRSAHLQAHQKVHTGEKPYKCGECGKGFKWSLNLDMHQRVHTGEKPYTCGE
CGKHFSQASSLQLHQSVHTGEKPYKCDVCGKVFSRSSQLQYHRRVHTGEKPYKCEICGKR
FSWRSNLVSHHKIHAAGTFYENDENSKNIRELSEGGSSTR
NT seq 2103 nt   +upstreamnt  +downstreamnt
atgaccacattcaaggagggactgaccttcaaggatgtggctgtggtcttcactgaggag
gagctggggctgctggaccctgtccagaggaatctgtaccaagatgtgatgctggagaac
ttcaggaacctgctgtcagtggggcatcaccccttcaaacatgatgtattccttttagaa
aaggaaaaaaagcttgatataatgaagacagcaactcaaagaaaagggaaatcagcagac
aagatccaaagtgaggtggagactgttccagaagcaggacgacatgaagagctttactgg
gggcaaatctggaaacagattgcaagtgatttaatcaagtatgaagactctatgataagt
atttctcggttccccagacaaggtgatttgtcctgccaggttagggcaggactatataca
actcacacaggacagaaattttaccaatgtgatgagtacaaaaaatccttcactgatgtc
ttcaactttgatcttcatcaacagttacactcaggagagaagtctcatacatgtgatgag
tgtggaaaaagcttctgttacatctcagcccttcatattcatcaaagagtccacatggga
gagaaatgctataagtgtgacgtgtgtggtaaggaatttagtcagagctcacatcttcaa
actcatcagagagtccacactgtagagaaaccattcaaatgtgtggaatgtgggaaaggc
ttcagtcgtagatcaacacttactgtacattgcaaattacactcaggagagaaaccttac
aattgtgaggaatgtggaagggccttcatacatgcttcccatcttcaggaacatcagaga
attcatactggggagaaaccattcaaatgtgatacatgtggtaagaacttccgtcgtaga
tcagcacttaataatcattgcatggtccacacaggagagaaaccatacaaatgtgaggac
tgtggtaagtgtttcacttgtagctcaaaccttcgtatccatcaaagggtccacacagga
gagaaaccttacaagtgtgaagaatgtggtaagtgctttattcagccttcacaatttcag
gcccatcggagaatccacactggagagaaaccatacgtatgtaaagtgtgtggtaagggt
ttcatttacagttcaagttttcaggcccatcagggagtccacactggagagaagccatac
aaatgcaatgagtgtgggaagagcttcagaatgaaaattcattatcaagtgcatctggta
gtccacacaggggaaaaaccctataaatgtgaagtatgtggtaaagccttccgtcagagt
tcatatcttaaaatccatctgaaagcacatagtgtacagaaaccttttaagtgtgaagag
tgtgggcagggcttcaatcagagctcacgacttcagattcaccagctgatccataccggt
gagaaaccatacaaatgtgaagagtgcggaaagggatttagtcgtagagcagatcttaaa
attcattgtaggatccacacaggggagaaaccatataattgtgaggagtgtgggaaggtc
ttcagtcaggcctcgcatcttctaacccatcagagagttcacagtggggaaaaaccattt
aaatgtgaagagtgtgggaagagcttcagtcggagtgcacaccttcaagcccatcaaaaa
gtccacactggagaaaagccatacaaatgtggggagtgtggaaagggcttcaagtggagc
ttgaaccttgacatgcatcagagggtgcacacaggagaaaaaccctatacatgtggggag
tgtgggaagcacttcagtcaggcctcaagtctccaacttcatcagagtgtccacacagga
gagaaaccatacaaatgtgatgtatgtggtaaagtcttcagtcggtcttcacaattacag
tatcataggcgagttcacactggggaaaaaccttacaaatgtgagatatgtggtaagagg
ttcagctggcgatcaaatcttgtaagtcatcacaaaattcatgctgctggtacattttat
gaaaatgatgagaatagtaagaacatcagagagttgtcagagggaggaagttctacaagg
tga

KEGG   Homo sapiens (human): 10793
Entry
10793             CDS       T01001                                 
Symbol
ZNF273, HZF9
Name
(RefSeq) zinc finger protein 273
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    10793 (ZNF273)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    10793 (ZNF273)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    10793 (ZNF273)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_6 KRAB zf-C2H2_11 Zn-ribbon_8 XPA_N zf-C2H2_jaz zf-C2H2_8 zinc_ribbon_15 TFIIS_C Glyco_transf_20 zf-C2HE C1_4
Other DBs
NCBI-GeneID: 10793
NCBI-ProteinID: NP_066971
OMIM: 604756
HGNC: 13067
Ensembl: ENSG00000198039
Pharos: Q14593(Tdark)
UniProt: Q14593
LinkDB
Position
7:64877603..64937316
AA seq 569 aa
MSSAPRGPPSVAPLPAGIGRSTAKTPGLPGSLEMGPLTFRDVAIEFSLEEWQCLDTSQQN
LYRNVMLDNYRNLVFLGIAVSKPDLITCLEQGKEPCNMKRHAMVAKPPVVCSHFAQDLWP
KQGLKDSFQKVILRRYGKYGHENLQLRKGCKSADEHKVHKRGYNGLNQCLTTTQSKIFQC
DKYVKVLHKFSNSNIHKKRQTGKKPFKCKECGKSCCILSQLTQHKKTATRVNFYKCKTCG
KAFNQFSNLTKHKIIHPEVNPYKCEECGKAFNQSLTLTKHKKIHTEEKPYKCEDCGKVFS
VFSVLTKHKIIHTGTKPYNCEECGKGFSIFSTLTKHKIIHTGEKPYKCNECGKAFNWSST
LTKHKRIHTGEKPYKCEECGKAFNQSSTLTRHKIVHTGEKPYKCEECGKAFKRSTTLTKH
KRIYTKEKPYKCEECGKAFSVFSTLTKHKIIHTGAKPYKCEECGSAFRAFSTLTEHKRVH
TGEKPYKCNECGKAFNWSSTLTKHKRIHTGEKPYKCEECGKAFNRSSNLTRHKKIHTGEK
PYKPKRCDSAFDNTPNFSRHKRNHMGEKS
NT seq 1710 nt   +upstreamnt  +downstreamnt
atgtcctctgctcctagaggtccaccttctgtggccccgttacctgcaggtattgggaga
tccacagctaagacgccaggactccctggaagcctagaaatgggaccactgacatttagg
gatgtggccatagaattctctctggaggagtggcaatgcctggacacttcacagcagaat
ttgtataggaatgtgatgttagataactacagaaacctggtcttcctgggtattgctgtc
tctaagccagacctgatcacttgtctggagcaaggaaaagagccctgcaatatgaagaga
catgcgatggtagccaaacccccagttgtgtgttctcattttgcccaagacctttggcca
aagcagggcttaaaagattcttttcaaaaagtgatactgagaagatatggaaaatatgga
catgagaatttacaattaagaaaaggctgtaaaagtgcggatgagcataaggtgcacaaa
agaggttataatggacttaaccaatgtttgacaactacccagagcaaaatatttcaatgt
gataaatatgttaaagtccttcataaattctcaaattcaaatatacataagaaaagacaa
actggaaagaaacctttcaaatgtaaagaatgtggcaaatcatgttgcatactttcacaa
ctaactcagcataagaaaactgctactagagtgaatttctacaaatgtaagacatgtgga
aaagcctttaaccagttctcaaatcttactaaacataagataattcatcctgaagtgaat
ccctacaaatgtgaagaatgtggcaaagcctttaaccagtccttaactcttactaaacat
aaaaaaattcatactgaagagaaaccttacaaatgtgaagattgtggcaaagtctttagt
gtattttcagtccttactaaacataagataattcatacaggaacaaaaccctacaattgt
gaagaatgtggcaaaggctttagtatattctcaacccttactaaacataagataattcat
actggagagaaaccctacaaatgcaatgaatgtggtaaagcctttaactggtcctcaact
cttactaaacataagagaattcatactggagagaaaccctacaaatgtgaagaatgtggc
aaagcttttaaccagtcctcaacccttactagacataagatagttcatactggagagaaa
ccctacaaatgtgaagaatgtggtaaagcctttaaacggtccacaactcttactaaacat
aagagaatttatactaaagagaaaccatacaaatgtgaagaatgtggaaaagcctttagt
gtattctcaacccttactaaacataagataattcatactggagcaaaaccttacaaatgt
gaagaatgtggcagtgcctttagggcattctcaacccttactgaacataagagagttcat
actggagagaaaccttacaaatgcaatgaatgtggtaaagcctttaactggtcctcaact
cttactaaacataagagaattcatactggagagaagccctacaaatgtgaagaatgtggc
aaagcttttaaccggtcctcaaaccttactcgacataagaaaattcatactggagagaaa
ccatacaaacctaaaagatgtgacagtgcttttgacaacaccccaaacttttctagacat
aaaagaaatcatatgggtgagaaatcctag

KEGG   Homo sapiens (human): 10794
Entry
10794             CDS       T01001                                 
Symbol
ZNF460, HZF8, ZNF272
Name
(RefSeq) zinc finger protein 460
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    10794 (ZNF460)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    10794 (ZNF460)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    10794 (ZNF460)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 KRAB zf-C2H2_jaz zf-C2H2_6 Zn-ribbon_8 zf-C2H2_11 zinc_ribbon_15 Zn_ribbon_SprT HVO_2753_ZBP Zn_Tnp_IS1595 DUF3268
Other DBs
NCBI-GeneID: 10794
NCBI-ProteinID: NP_006626
OMIM: 604755
HGNC: 21628
Ensembl: ENSG00000197714
Pharos: Q14592(Tdark)
UniProt: Q14592
LinkDB
Position
19:57279982..57294069
AA seq 562 aa
MAAAWMAPAQESVTFEDVAVTFTQEEWGQLDVTQRALYVEVMLETCGLLVALGDSTKPET
VEPIPSHLALPEEVSLQEQLAQGVPRYSYLGQAMDQDGPSEMQEYFLRPGTDPQSEKLHG
KMSLEHEGLATADGICSMMIQNQVSPEDALYGFDSYGPVTDSLIHEGENSYKFEEMFNEN
CFLVQHEQILPRVKPYDCPECGKAFGKSKHLLQHHIIHTGEKPYKCLECGKDFNRRSHLT
RHQRTHNGDKPFVCSECGRTFNRGSHLTRHQRVHSGEKPFVCNECGKAFTYRSNFVLHNK
SHNEKKPFACSECGKGFYESTALIQHFIIHTGERPFKCLECGKAFNCRSHLKQHERIHTG
EKPFVCSQCGKAFTHYSTYVLHERAHTGEKPFECKECGKAFSIRKDLIRHFNIHTGEKPY
ECLQCGKAFTRMSGLTRHQWIHTGEKPYVCIQCGKAFCRTTNLIRHFSIHTGEKPYECVE
CGKAFNRRSPLTRHQRIHTAEKSHEPIQSGNVSCESTDLIQHSIIHTESSPVSAVNMETP
SIAAHSSSLDINGFIVEETLPL
NT seq 1689 nt   +upstreamnt  +downstreamnt
atggcggcggcgtggatggctccggcgcaggagtctgtgaccttcgaggatgtggctgtg
acatttacccaggaggagtgggggcagttggacgtgacccagagggccttgtacgtggag
gtgatgctggagacctgtgggcttctggtcgcactgggtgacagcacaaaacctgagacc
gtagagcctatcccttctcatctggccttgcctgaggaagtctcactccaggaacagctg
gcacagggagtcccaagatactcctatttggggcaggccatggatcaagatgggccatct
gaaatgcaggaatactttttgagaccagggacagacccacagagtgagaaactccatggg
aaaatgagccttgaacacgaaggtttggcgacagctgatggtatttgttcaatgatgata
cagaaccaagtctcaccagaagatgctctctatggatttgactcatatggaccagttaca
gattccttgattcatgaaggggaaaattcctataaattcgaggaaatgtttaatgagaat
tgcttccttgttcagcatgagcagattctccctcgtgtgaagccctatgattgcccagaa
tgtgggaaagccttcggcaagagcaaacacctccttcagcatcacatcatccatactggg
gagaagccctataaatgcctggagtgtgggaaagacttcaaccgcaggtcacacctcaca
cggcaccagcggactcacaatggagataagccctttgtgtgcagtgaatgtggaaggacc
ttcaatcgcgggtcgcaccttacacggcaccagcgggttcacagtggagagaagcctttt
gtgtgcaatgaatgtggaaaggcctttacctaccgctccaattttgtcttgcataacaag
agccacaatgagaagaaacccttcgcatgcagcgaatgtggaaaaggcttttatgagagt
acagccctcattcaacacttcattatccatactggggagaggccctttaagtgccttgag
tgtgggaaggccttcaactgcaggtcacacctcaagcagcatgagcggattcacactggt
gagaagccctttgtgtgcagtcaatgtggaaaggccttcactcactattccacctatgtc
ctgcatgaaagagcccacactggagaaaagccttttgagtgcaaagaatgtgggaaagcc
tttagcattcgaaaagacctcattcgacacttcaacatccacactggagagaagccctat
gagtgtttacagtgtggaaaggcttttacccgcatgtcagggctcacaaggcaccagtgg
attcatactggagagaagccgtatgtatgcatccaatgtgggaaagccttttgtcggacc
acaaacctgattcgacactttagcatccacactggagagaagccctatgaatgcgtggag
tgcgggaaggccttcaaccgcaggtcacccctcacaaggcaccagcggattcacactgca
gagaagtcccacgaacccatccagagtgggaacgtttcttgtgagagcacagatctcatt
caacactccatcatccacactgagagtagcccagtgagtgcagtgaatatggaaacgcct
tcaattgccgctcattcctcctcactcgacatcaacggattcatagtggaagaaacccta
ccattgtaa

KEGG   Homo sapiens (human): 10795
Entry
10795             CDS       T01001                                 
Symbol
ZNF268, HZF3
Name
(RefSeq) zinc finger protein 268
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    10795 (ZNF268)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    10795 (ZNF268)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    10795 (ZNF268)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_6 KRAB Zn-ribbon_8 C1_4 zf-C2H2_jaz zinc_ribbon_15 zf-met
Other DBs
NCBI-GeneID: 10795
NCBI-ProteinID: NP_001159353
OMIM: 604753
HGNC: 13061
Ensembl: ENSG00000090612
Pharos: Q14587(Tbio)
UniProt: Q14587 Q2TB61
Structure
LinkDB
Position
12:133181495..133214832
AA seq 947 aa
MATRVRTASIWVPPLQERNSSWDRIRKLQGQESILGQGTPGLQPLPGTPRQKQKSRRIEK
VLEWLFISQEQPKITKSWGPLSFMDVFVDFTWEEWQLLDPAQKCLYRSVMLENYSNLVSL
GYQHTKPDIIFKLEQGEELCMVQAQVPNQTCPNTVWKIDDLMDWHQENKDKLGSTAKSFE
CTTFGKLCLLSTKYLSRQKPHKCGTHGKSLKYIDFTSDYARNNPNGFQVHGKSFFHSKHE
QTVIGIKYCESIESGKTVNKKSQLMCQQMYMGEKPFGCSCCEKAFSSKSYLLVHQQTHAE
EKPYGCNECGKDFSSKSYLIVHQRIHTGEKLHECSECRKTFSFHSQLVIHQRIHTGENPY
ECCECGKVFSRKDQLVSHQKTHSGQKPYVCNECGKAFGLKSQLIIHERIHTGEKPYECNE
CQKAFNTKSNLMVHQRTHTGEKPYVCSDCGKAFTFKSQLIVHQGIHTGVKPYGCIQCGKG
FSLKSQLIVHQRSHTGMKPYVCNECGKAFRSKSYLIIHTRTHTGEKLHECNNCGKAFSFK
SQLIIHQRIHTGENPYECHECGKAFSRKYQLISHQRTHAGEKPYECTDCGKAFGLKSQLI
IHQRTHTGEKPFECSECQKAFNTKSNLIVHQRTHTGEKPYSCNECGKAFTFKSQLIVHKG
VHTGVKPYGCSQCAKTFSLKSQLIVHQRSHTGVKPYGCSECGKAFRSKSYLIIHMRTHTG
EKPHECRECGKSFSFNSQLIVHQRIHTGENPYECSECGKAFNRKDQLISHQRTHAGEKPY
GCSECGKAFSSKSYLIIHMRTHSGEKPYECNECGKAFIWKSLLIVHERTHAGVNPYKCSQ
CEKSFSGKLRLLVHQRMHTREKPYECSECGKAFIRNSQLIVHQRTHSGEKPYGCNECGKT
FSQKSILSAHQRTHTGEKPCKCTECGKAFCWKSQLIMHQRTHVDDKH
NT seq 2844 nt   +upstreamnt  +downstreamnt
atggccaccagggtccggacagcttctatttgggtcccacctctccaagaacgaaacagt
tcatgggataggatcagaaagctccaaggtcaggaatccatcttgggccaagggactcct
ggtctgcaacctctccctggaacacccaggcagaagcagaagagtcgcagaatagagaaa
gtcctagagtggctgtttatttcccaagagcagccaaaaatcaccaagtcctggggacct
ttgtcattcatggatgtgtttgtggattttacctgggaggagtggcagctgctagaccca
gcacagaagtgcctgtacaggagtgtgatgttggagaactatagcaacctggtgtcccta
gggtaccaacacaccaaacctgatatcatcttcaagttggaacaaggagaagagctgtgt
atggtgcaggcccaagttccaaatcagacctgtccaaacacagtctggaaaattgatgat
cttatggattggcatcaggaaaataaagacaagctgggaagtacggcaaaaagctttgaa
tgcactacatttggaaaactatgtcttcttagtacaaagtatctttcaagacaaaaacct
cataaatgtggcacgcatggaaagagtttgaaatatatagatttcactagtgattatgct
agaaataatcctaatgggtttcaggtacatggaaaatcattcttccattctaaacatgag
caaactgttattggaataaaatactgtgaaagtattgaatctggaaaaaccgtcaataag
aaatcgcaacttatgtgccaacaaatgtatatgggcgaaaaaccctttggatgcagctgt
tgtgagaaagccttcagcagcaagtcataccttctagtgcatcagcaaactcatgccgaa
gagaaaccctatggttgtaatgaatgtgggaaagacttcagtagtaaatcatacctcatt
gtacatcagagaattcatacaggagagaaactacatgaatgcagtgaatgcaggaaaaca
ttcagtttccattcacagcttgttatacatcagagaattcacacaggtgagaatccctat
gagtgctgtgaatgtgggaaagtcttcagtaggaaagaccagcttgtttcacaccagaaa
actcattcaggacagaaaccatatgtgtgtaatgaatgtgggaaagcttttggtttaaaa
tcacagctcattatacatgaaagaattcatacaggagagaaaccatatgaatgcaatgaa
tgtcagaaagcctttaatacaaagtcaaaccttatggtacatcagagaacccatacaggg
gagaaaccttatgtttgtagtgattgtggaaaagcctttacattcaagtcacagctcatt
gtacatcaggggattcacacaggagtaaagccctatgggtgtattcagtgtggtaaagga
ttcagtttgaaatcacagctcattgtacatcagagaagtcacacaggaatgaaaccttat
gtatgcaatgaatgtggcaaagccttcaggagcaagtcataccttattatacatacaagg
actcatacaggagaaaaactccatgaatgcaacaattgtgggaaagccttcagttttaaa
tcacagctcattatacatcagaggattcatacaggagagaacccctatgaatgccatgaa
tgtgggaaagccttcagtcggaaataccagcttatttcacaccagagaactcatgcagga
gagaagccttatgaatgcaccgactgtggaaaggcttttggtttaaagtcacagcttatt
atacaccagagaactcatacaggggagaaaccatttgaatgtagtgagtgtcagaaagcc
tttaatacaaagtcaaacctgattgtacatcagagaactcatacaggagagaaaccctat
agttgtaatgaatgtggaaaagcctttacgttcaaatcacagctcattgtacataaagga
gtgcacactggagtaaaaccctatggatgcagtcaatgtgcaaaaacctttagtttgaag
tcccagctcattgtacatcagagaagtcacacaggagtaaaaccatatggatgcagtgag
tgtgggaaagccttcaggagcaagtcataccttattatacatatgagaactcatacagga
gagaaaccacatgagtgcagggaatgcgggaaatcctttagtttcaattcacaactcatt
gtgcatcagagaattcacacaggagaaaatccctatgaatgcagtgaatgtgggaaagcc
tttaataggaaagaccagctcatttcacatcagcgaactcatgcaggggaaaagccttat
gggtgcagtgaatgtgggaaagcttttagcagcaagtcatacctaattatacacatgaga
actcattcaggtgaaaaaccatatgaatgtaatgaatgtgggaaagccttcatttggaaa
tcactactcattgtacatgagcgaactcatgcaggggtcaacccttataaatgcagtcaa
tgtgagaaatccttcagtgggaaattacgccttcttgtacaccagagaatgcacacaaga
gagaaaccatatgaatgcagtgagtgtggaaaagccttcattaggaattctcaactcatt
gtacatcaaagaactcattcaggagagaaaccctatgggtgcaatgaatgtgggaaaacc
ttctctcaaaaatcaattctcagtgcacatcagagaacacatacaggagagaagccttgt
aagtgcactgaatgtgggaaagccttttgttggaagtcacagctcattatgcatcagaga
actcatgtagatgacaaacattga

KEGG   Homo sapiens (human): 10838
Entry
10838             CDS       T01001                                 
Symbol
ZNF275
Name
(RefSeq) zinc finger protein 275
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    10838 (ZNF275)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    10838 (ZNF275)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    10838 (ZNF275)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_jaz Zn-ribbon_8 zf-C2H2_6 zf-met zf-C2H2_8 HypA zinc_ribbon_15 zf-LYAR Ribosomal_L34e zf-C2HE C1_4 LIM
Other DBs
NCBI-GeneID: 10838
NCBI-ProteinID: NP_001073954
HGNC: 13069
Ensembl: ENSG00000063587
UniProt: A6NFS0
LinkDB
Position
X:153334153..153352926
AA seq 329 aa
MMSHPCVSLLGVPVLNPALVPHLAQGQVLLVSDPSPNTDPAKYSESTSATRHQMKGEDAQ
PQEMASTSFPRASGPSPEFRQHGDSDGKRGSPQNLPIEHHFACKECGDTFRLKVLLVQHQ
RVHSEEKGWECGDCGKVFRGVAEFNEHRKSHVAAEPQPGPSRALENAAEKREQMEREAKP
FECEECGKRFKKNAGLSQHLRVHSREKPFDCEECGRSFKVNTHLFRHQKLHTSEKPFACK
ACSRDFLDRQELLKHQRMHTGHLPFDCDDCGKSFRGVNGLAEHQRIHSGAKPYGCPHCGK
LFRRSSELTKHRRIHTGEKPYACGLPWAL
NT seq 990 nt   +upstreamnt  +downstreamnt
atgatgagtcatccgtgtgtgtctcttttgggcgttcctgttttaaatcctgccttggtc
cctcacctggcacaaggacaagtgctactggtgtcagacccatcgcccaacactgatcct
gctaagtactctgaaagcacctccgcgacccgacaccagatgaagggggaagatgcccag
ccacaggagatggcgtccacaagcttcccaagggccagtggtcccagtcctgaattcaga
cagcacggggactctgacgggaagagagggagcccacagaatctgcccatagaacatcat
tttgcttgtaaagagtgtggggacacctttcggcttaaagtcctgcttgtccagcaccag
agagtccacagtgaggagaagggctgggaatgtggcgactgcgggaaggtctttaggggg
gtggcggagtttaatgagcacaggaaaagccacgtagctgcggagccccagcccggcccc
agtagggccctggagaatgccgcggagaagagggagcagatggagagggaggcaaagccc
ttcgagtgcgaggagtgcggaaaacggtttaagaagaatgcaggcctgagtcagcatctg
agggtccacagcagagagaagccctttgattgcgaggaatgcgggcggtcgttcaaagtc
aacacccacctcttccgacatcagaaacttcacacttcggaaaagcctttcgcctgcaag
gcgtgcagcagggatttcctggatcgccaggagcttctcaagcaccagcgcatgcacact
ggccacctgcccttcgactgcgacgactgcggcaagtccttccgaggggtcaacgggctg
gccgagcaccagcgcatccacagtggggccaagccatacgggtgtccccactgcggcaag
ctcttccgaaggagctcggagctcaccaagcaccggcggatccacacgggcgagaagccc
tacgcctgcggccttccgtgggccctctga

KEGG   Homo sapiens (human): 113835
Entry
113835            CDS       T01001                                 
Symbol
ZNF257, BMZF-4, BMZF4
Name
(RefSeq) zinc finger protein 257
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    113835 (ZNF257)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    113835 (ZNF257)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    113835 (ZNF257)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 KRAB XPA_N zf-C2H2_6 zf-C2H2_jaz zf-C2H2_11 Zn-ribbon_8
Other DBs
NCBI-GeneID: 113835
NCBI-ProteinID: NP_258429
OMIM: 606957
HGNC: 13498
Ensembl: ENSG00000197134
Pharos: Q9Y2Q1(Tdark)
UniProt: Q9Y2Q1
LinkDB
Position
19:22052484..22091480
AA seq 563 aa
MGPLTIRDVTVEFSLEEWHCLDTAQQNLYRDVMLENYRNLVFLGIAVSKPDLITCLEQGK
EPCNMKRHEMVAKPPVMCSHIAEDLCPERDIKYFFQKVILRRYDKCEHENLQLRKGCKSV
DECKVCKGGYNGLNQCLITTQSKMYQCDKYVKVFYKFSNSDRHKIRHTEKKTCKCKECGK
SFCMLSQLTRHKRIHIRENSHKCEECGKAFNQSSALTRHKMTHTGEKPYKCEECGKAFNR
SSHLTQHKVIHTREKPYKCEECGKAFNRSSHITQHKRIHNREKPFKYDECCKAFKWSSAL
TTLTQHKRIHTGEKPYKCEECGKAFNQSSALTRHKMIHTGEKPFQCEECGKAFNRSSHLT
QHKIIHTKEKPYKCEECGKAFNRSSHLTKHKRIHTREKAYKCDEYCKAFNWSSALTTLTQ
HKIIHTGEKPYKCEECGKAFNRSSYLIRHKIIHTGEKPYKCEECGKAFNQSSHLTQHKII
HTGEKPYKCEECGKAFNRSSHLSQHKIIHTGEKPYKCEECGKPFNRFSYLTVHKRIHAGE
NPNKYEECGKACNHSSNLTKHNS
NT seq 1692 nt   +upstreamnt  +downstreamnt
atgggaccactgacaattagggatgtgactgtagaattctctctggaggagtggcattgc
ctggacactgcacagcagaatttatatagggatgtgatgttagagaactacagaaacctg
gtcttcctgggtattgctgtctctaagccagacctgatcacctgtctggagcaaggaaaa
gagccctgtaatatgaagagacatgagatggtagccaaacccccagttatgtgttctcat
attgctgaagacctttgcccagagcgagacataaaatattttttccaaaaagtcatactg
aggagatatgataaatgtgaacatgagaatttacaattaagaaagggctgtaaaagtgtg
gatgagtgtaaggtgtgcaaaggaggttataatggacttaaccaatgtctgataactacc
cagagcaaaatgtatcaatgtgataaatatgtaaaagtcttctataagttttcaaattca
gatagacataagataagacatactgaaaagaaaacttgcaaatgtaaagaatgtggcaaa
tcattttgcatgctttcacaactaactcgacataagagaattcatattagagagaattcc
cacaaatgtgaagaatgtggcaaagcctttaaccagtcctcagctcttactcgacataag
atgactcatactggagagaaaccctacaaatgtgaagagtgtggaaaagcttttaaccgg
tcttcacaccttactcaacataaggtaattcatactagagagaaaccctacaaatgtgaa
gagtgtggcaaagcctttaaccggtcttcacacattactcaacataagagaattcataat
agagagaagcccttcaaatatgatgaatgttgcaaagcctttaagtggtcctcagctctt
actacccttactcaacataagagaattcatactggagagaaaccctacaaatgtgaagag
tgtggcaaagcctttaaccagtcctcagcccttactcgacataagatgattcatactgga
gagaaacccttccaatgtgaagagtgtggcaaagcttttaaccggtcttcacaccttact
caacataagataattcatactaaagagaaaccctacaaatgtgaagagtgtggaaaagcc
tttaaccggtcttcacaccttactaaacataagagaattcatactagagagaaggcctac
aaatgtgatgaatattgcaaagcttttaactggtcctcagctcttactacccttactcag
cataagataattcatactggagagaaaccctacaaatgtgaagagtgtggcaaagccttt
aaccggtcttcataccttattcgacataagataattcatactggagagaaaccctacaaa
tgtgaagagtgtggcaaagcctttaaccagtcttcacaccttactcaacataaaataatt
catactggggagaagccctacaaatgtgaagaatgtggcaaagcctttaaccggtcttca
cacctttctcaacataagataattcatactggagagaaaccctacaaatgtgaagaatgt
ggcaagccttttaatcgtttctcataccttaccgtacataagagaattcatgctggagag
aaccccaacaaatatgaagaatgtggcaaagcttgtaaccattcctcaaaccttactaaa
cataattcataa

KEGG   Homo sapiens (human): 114026
Entry
114026            CDS       T01001                                 
Symbol
ZIM3, ZNF264, ZNF657
Name
(RefSeq) zinc finger imprinted 3
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    114026 (ZIM3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    114026 (ZIM3)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    114026 (ZIM3)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 KRAB Zn-ribbon_8 zf-C2H2_6 zinc_ribbon_15 C1_4 zf-met zf-C2HC_2 zf-C2H2_jaz XPA_N
Other DBs
NCBI-GeneID: 114026
NCBI-ProteinID: NP_443114
HGNC: 16366
Ensembl: ENSG00000141946
Pharos: Q96PE6(Tdark)
UniProt: Q96PE6
LinkDB
Position
19:complement(57134096..57145202)
AA seq 472 aa
MNNSQGRVTFEDVTVNFTQGEWQRLNPEQRNLYRDVMLENYSNLVSVGQGETTKPDVILR
LEQGKEPWLEEEEVLGSGRAEKNGDIGGQIWKPKDVKESLAREVPSINKETLTTQKGVEC
DGSKKILPLGIDDVSSLQHYVQNNSHDDNGYRKLVGNNPSKFVGQQLKCNACRKLFSSKS
RLQSHLRRHACQKPFECHSCGRAFGEKWKLDKHQKTHAEERPYKCENCGNAYKQKSNLFQ
HQKMHTKEKPYQCKTCGKAFSWKSSCINHEKIHNAKKSYQCNECEKSFRQNSTLIQHKKV
HTGQKPFQCTDCGKAFIYKSDLVKHQRIHTGEKPYKCSICEKAFSQKSNVIDHEKIHTGK
RAYECDLCGNTFIQKKNLIQHKKIHTGEKPYECNRCGKAFFQKSNLHSHQKTHSGERTYR
CSECGKTFIRKLNLSLHKKTHTGQKPYGCSECGKAFADRSYLVRHQKRIHSR
NT seq 1419 nt   +upstreamnt  +downstreamnt
atgaacaattcccagggaagagtgaccttcgaggatgtcactgtgaacttcacccagggg
gagtggcagcggctgaatcccgaacagagaaacttgtacagggatgtgatgctggagaat
tacagcaaccttgtctctgtgggacaaggggaaaccaccaaacccgatgtgatcttgagg
ttggaacaaggaaaggagccatggttggaggaagaggaagtgctgggaagtggccgtgca
gaaaaaaatggggacattggagggcagatttggaagccaaaggatgtgaaagagagtctc
gcaagagaagtcccatcaatcaataaggaaacgctgactacgcagaaaggtgtagaatgt
gacggatctaagaaaatacttccactgggcatagatgatgtatcttccttgcaacactat
gtacaaaataattctcacgatgataatggatacagaaaattagttggcaataatccatcc
aaatttgtaggacaacaactgaaatgtaatgcctgtagaaagttattcagttcaaagtca
cgccttcaaagtcacctgaggaggcatgcctgtcaaaaaccctttgaatgtcatagctgt
ggaagagcattcggggagaagtggaagcttgataaacatcagaaaactcacgcagaggaa
aggccctataaatgtgagaactgtggaaatgcctacaagcagaagtcaaatctctttcaa
catcagaaaatgcatactaaagagaaaccctatcagtgtaagacatgtggaaaagccttt
tcctggaaatcatcctgcattaatcatgagaaaattcataatgccaagaaatcctatcag
tgtaatgaatgtgagaaatccttcaggcagaactcaaccctcattcaacataaaaaagtt
cacactggacaaaaaccctttcaatgtacggactgtggaaaggctttcatttacaagtca
gatcttgtgaaacaccagagaatacacacgggagagaaaccctataaatgtagcatatgt
gagaaggccttttcccagaaatccaatgtcatcgatcatgagaaaattcacactgggaag
agagcttatgagtgtgatctatgtggaaatacctttatccagaagaaaaacctcattcaa
cataaaaaaatccatactggggaaaagccctatgaatgtaacagatgtggaaaagccttc
tttcagaagtcaaaccttcatagccatcagaaaactcatagcggagagaggacctataga
tgtagtgaatgtggaaaaaccttcatccggaaattaaaccttagtttgcataaaaaaacc
catactggacaaaaaccttatggatgttctgaatgcggtaaagccttcgctgacaggtca
taccttgttaggcaccagaaaagaattcactccagatag

KEGG   Homo sapiens (human): 115196
Entry
115196            CDS       T01001                                 
Symbol
ZNF554
Name
(RefSeq) zinc finger protein 554
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    115196 (ZNF554)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    115196 (ZNF554)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    115196 (ZNF554)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 KRAB zf-C2H2_jaz zf-C2H2_6 zf-C2H2_11 Zn-ribbon_8 zf_UBZ Zn_ribbon_SprT zf-AN1 zinc_ribbon_15 XPA_N zf-H2C2_5 HVO_2753_ZBP HypA Siva C1_4 zf-met
Other DBs
NCBI-GeneID: 115196
NCBI-ProteinID: NP_001096121
HGNC: 26629
Ensembl: ENSG00000172006
Pharos: Q86TJ5(Tdark)
UniProt: Q86TJ5 B3KNM4
LinkDB
Position
19:2819868..2836735
AA seq 538 aa
MVTCAHLGRRARLPAAQPSACPGTCFSQEERMAAGYLPRWSQELVTFEDVSMDFSQEEWE
LLEPAQKNLYREVMLENYRNVVSLEALKNQCTDVGIKEGPLSPAQTSQVTSLSSWTGYLL
FQPVASSHLEQREALWIEEKGTPQASCSDWMTVLRNQDSTYKKVALQEEPASGINMIKLI
REDGGWKQLEDSHEDPQGLLSQKASLHVVAVPQEKATAWHGFGENGNLSPALVLSQGSSK
GNHLCGSELDITSLASDSVLNHHQLGYADRRPCESNECGNAIRQNSHFIQHGGKMFVYLE
NGQSLNHGMALTIHNKINTAEKPFECHQCGKVFNRRHSLSEHQRIHTGEKPYECQECGRA
FTHSSTLTRHLRTHTGEKPYGCGECGKAFNRISSLTQHQRIHTGEKPYKCEDCGKSFCQS
SYLILHKRTHTGEKPYECSECGKAFSDRSSLNQHERTHTGENPYECKQCGRAFSQRSSLV
RHERTHTGEKPYRCQECGKAFSQSSSLVTHQKTHSSQKTYKIIDCGKAFYQNRHLIGY
NT seq 1617 nt   +upstreamnt  +downstreamnt
atggtcacctgcgcccacctgggccggcgcgcgcggctcccggcagctcagccctctgcc
tgcccaggaacctgcttttcccaagaggagagaatggctgctgggtacctgccccgctgg
tcccaggaattagtaacctttgaggacgtgtccatggacttctcccaggaggagtgggag
ttgctggagcctgctcagaagaacctgtacagagaggtgatgctggagaactacaggaac
gtggtctccctggaagccttgaagaaccaatgtactgatgtggggattaaagagggtcca
ctttccccagcacaaacctcacaagtcactagtctttcctcatggacggggtatttactt
tttcaaccagtggcttcttcccacttggagcaaagagaagccctgtggatagaggaaaaa
ggaactcctcaagcctcctgttcagattggatgactgtactaagaaaccaagactcaact
tacaagaaggtggctttgcaggaggaaccagccagtggtataaatatgataaagcttatc
agagaagatgggggatggaagcagttagaggacagccatgaagacccccaggggcttttg
agccaaaaggcatcccttcacgtagtggccgttcctcaggagaaggctactgcatggcat
ggatttggggaaaatggtaatctgagcccagcccttgttttatcacagggaagctctaaa
gggaaccacttgtgtggcagcgagttagatattacaagcttggcatccgattcagtctta
aaccaccatcagctgggatatgcagatcggagaccttgtgaaagtaatgaatgtggaaat
gccatccgccagaacagtcactttattcaacacggggggaagatgtttgtgtatttggaa
aatgggcagtcattgaaccacggtatggccctgactatccacaacaaaatcaacacggca
gagaaaccctttgagtgccaccagtgtgggaaggtgttcaaccggaggcattctttgagc
gaacatcaaagaattcacacgggggagaaaccctacgagtgtcaggagtgtgggcgagcc
tttacgcacagctccaccctcacgcgccatctgagaactcatactggagagaagccctac
gggtgcggtgagtgcgggaaagccttcaacaggatctcatcgctgactcagcatcagagg
attcacaccggggaaaagccctataaatgtgaagactgtgggaaatccttctgccagagc
tcttacctgatcttgcacaagaggacacacaccggagagaagccctacgaatgcagtgaa
tgtggaaaggccttcagtgaccgttcctctctcaaccagcacgagcgaactcacacgggc
gagaacccctatgaatgtaagcagtgtgggagagccttcagccagaggtcttcccttgtg
aggcacgagagaactcacactggagagaaaccctacaggtgtcaggaatgtgggaaagcc
ttcagccagagctcatcccttgtcacacatcagaaaactcacagcagccagaaaacctat
aaaatcattgactgtgggaaagcgttctaccagaacagacatcttattggatattag

KEGG   Homo sapiens (human): 115509
Entry
115509            CDS       T01001                                 
Symbol
ZNF689, TIPUH1
Name
(RefSeq) zinc finger protein 689
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    115509 (ZNF689)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    115509 (ZNF689)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    115509 (ZNF689)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 KRAB zf_UBZ Zn-ribbon_8 zf-C2H2_11 zf-C2H2_6 zf-C2HC_2 DUF3268
Other DBs
NCBI-GeneID: 115509
NCBI-ProteinID: NP_612456
OMIM: 618033
HGNC: 25173
Ensembl: ENSG00000156853
Pharos: Q96CS4(Tdark)
UniProt: Q96CS4
LinkDB
Position
16:complement(30602558..30610775)
AA seq 500 aa
MAPPSAPLPAQGPGKARPSRKRGRRPRALKFVDVAVYFSPEEWGCLRPAQRALYRDVMRE
TYGHLGALGCAGPKPALISWLERNTDDWEPAALDPQEYPRGLTVQRKSRTRKKNGEKEVF
PPKEAPRKGKRGRRPSKPRLIPRQTSGGPICPDCGCTFPDHQALESHKCAQNLKKPYPCP
DCGRRFSYPSLLVSHRRAHSGECPYVCDQCGKRFSQRKNLSQHQVIHTGEKPYHCPDCGR
CFRRSRSLANHRTTHTGEKPHQCPSCGRRFAYPSLLAIHQRTHTGEKPYTCLECNRRFRQ
RTALVIHQRIHTGEKPYPCPDCERRFSSSSRLVSHRRVHSGERPYACEHCEARFSQRSTL
LQHQLLHTGEKPYPCPDCGRAFRRSGSLAIHRSTHTEEKLHACDDCGRRFAYPSLLASHR
RVHSGERPYACDLCSKRFAQWSHLAQHQLLHTGEKPFPCLECGRCFRQRWSLAVHKCSPK
APNCSPRSAIGGSSQRGNAH
NT seq 1503 nt   +upstreamnt  +downstreamnt
atggcgccaccttcggctccgctccctgcgcagggaccaggaaaggccagacccagtcgg
aaaaggggcaggaggccgagggctctgaagttcgtggacgtggccgtgtacttctccccg
gaggagtggggctgcctgcggcccgcgcagagggccctgtaccgggacgtgatgcgggag
acctacggtcacctgggcgcgctcgggtgcgcaggtcccaaaccagccctcatctcctgg
ttggaacgaaacaccgatgactgggaaccggctgctctagatccgcaggagtacccgaga
gggctaacagtccagagaaaaagcagaaccagaaagaagaatggggagaaggaagtattc
ccgcctaaggaggcaccccgaaaggggaagcgaggccggaggcccagcaaaccccgactg
attcctaggcagacgtccgggggccccatctgccctgactgcggctgtaccttccctgat
catcaggccctggagagccacaagtgcgcccagaatctaaaaaagccttacccttgccca
gactgtgggcgccgcttttcctatccatccctgctggtcagtcaccggcgggcacactcc
ggcgagtgcccctatgtttgtgaccagtgtggcaaacgtttctcccagcgcaagaacctc
tcccagcaccaggtcatccatacaggggagaagccctatcactgccctgactgtggtcgc
tgcttccggaggagccggtccttggccaatcaccggaccacacacacaggtgaaaaaccc
caccagtgccctagctgtggacgtcgcttcgcctacccctccctgctagccatccaccag
cgtacacacacgggagagaagccctacacttgcctcgagtgcaaccgccgcttccgccag
cgcacggccctcgtcatccaccagcgcatccacacgggcgagaagccctacccgtgcccg
gactgcgagcggcgcttctcctcctcctctcgcctggtcagtcaccggcgtgtgcactct
ggggagcgtccctatgcctgcgagcactgtgaggcccgcttctcccagcgcagcacgctg
ctccagcaccagctcttgcacaccggagagaagccctacccctgcccagactgtgggcgt
gccttccggcggagcggctccctggccatccatcgcagcacgcacacagaggagaagctg
cacgcctgcgacgactgtggtcgccgctttgcctacccctcactgctggccagccaccgg
cgcgtgcactcgggcgagcggccctatgcctgcgacctttgctccaagcgttttgctcag
tggagccacctggcccagcaccagctgctgcacacgggggagaagcctttcccctgcctc
gagtgtggccggtgcttccgccagaggtggtctctggctgtccacaagtgtagccccaag
gccccaaactgtagccctagatctgctatcgggggctccagtcagaggggcaacgcccat
tag

KEGG   Homo sapiens (human): 117608
Entry
117608            CDS       T01001                                 
Symbol
ZNF354B, KID2
Name
(RefSeq) zinc finger protein 354B
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    117608 (ZNF354B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    117608 (ZNF354B)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    117608 (ZNF354B)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_6 KRAB zf-C2H2_jaz Zn-ribbon_8 zf-C2H2_11 C1_4 zinc_ribbon_15 zf-met DUF3990
Other DBs
NCBI-GeneID: 117608
NCBI-ProteinID: NP_478137
HGNC: 17197
Ensembl: ENSG00000178338
Pharos: Q96LW1(Tdark)
UniProt: Q96LW1
LinkDB
Position
5:178859953..178885020
AA seq 612 aa
MAAGQREARPQVSLTFEDVAVLFTWDEWRKLAPSQRNLYRDVMLENYRNLVSLGLSFTKP
KVISLLQQGEDPWEVEKDSSGVSSLGCKSTPKMTKSTQTQDSFQEQIRKRLKRDEPWNFI
SERSCIYEEKLKKQQDKNENLQIISVAHTKILTVDRSHKNVEFGQNFYLKSVFIKQQRFA
KEKTPSKCEIQRNSFKQNSNLLNQSKIKTAEKRYKCSTCEKAFIHNSSLRKHQKNHTGEK
LFKCKECLKAFSQSSALIQHQRTHTGEKPYICKECGKAFSHSASLCKHLRTHTVEKCYRC
KECGKSFSRRSGLFIHQKIHAQENPHKYNPGRKASSYSTSLSGSQKIHLRKKSYLCNECG
NTFKSSSSLRYHQRIHTGEKPFKCSECGRAFSQSASLIQHERIHTGEKPYRCNECGKGFT
SISRLNRHRIIHTGEKLYNCNECGKALSSHSTLIIHERIHTGEKPCKCKVCGKAFRQSSA
LIQHQRMHTGERPYKCNECDKTFRCNSSLSNHQRIHTGEKPYRCLECGMSFGQSAALIQH
QRIHTGEKPFKCNTCGKTFRQSSSLIAHQRIHTGEKPYECNACGKLFSQRSSLTNHYKIH
IEEDSLKADLHV
NT seq 1839 nt   +upstreamnt  +downstreamnt
atggctgctgggcagcgggaagcgaggccccaggtgtcactgacattcgaggacgtggct
gtgctctttacctgggatgagtggagaaagctggctccttctcagagaaacttgtaccgg
gatgtgatgctggagaactataggaacctggtctcactgggactctcatttaccaaacca
aaagtcatctccctgttgcagcaaggagaagatccctgggaggtggagaaagacagttct
ggtgtctcctctctaggatgtaagagcacacctaaaatgacaaagtcaactcaaactcag
gattcatttcaggagcagataaggaaaagattgaaaagggatgaaccctggaacttcata
tcagaaagatcctgcatatatgaagagaaattaaagaaacagcaggacaaaaatgaaaat
ttacaaataatttcagttgcccatacaaaaatccttactgtagatagaagccataaaaat
gttgaatttggccaaaacttctacctgaaatcagtcttcattaagcaacagagatttgct
aaagaaaaaactccatcaaaatgtgaaatacaaagaaatagtttcaagcagaattcaaat
ttacttaaccaatcaaaaatcaaaacagcagagaaacgctataaatgcagtacatgtgaa
aaagccttcattcacaattcatcccttcgtaaacatcagaaaaaccacactggagaaaaa
ttatttaaatgtaaagaatgtttaaaagctttcagccaaagttctgctcttattcaacat
caaagaactcatacaggagagaaaccctatatatgtaaagaatgtgggaaagccttcagc
catagtgcatccctttgtaagcatttaaggacccatactgtggagaaatgctatagatgt
aaagaatgtggtaaatccttcagtcgaaggtctgggctttttatacatcaaaaaatccat
gctcaagaaaatccccataaatacaatccaggcaggaaggcatccagttacagcacttcc
ctttctggaagtcagaaaattcatctcagaaagaagtcctacttatgtaatgaatgtggc
aacacctttaagtctagctcatcccttcgttatcatcagagaattcacactggagagaag
ccttttaaatgtagtgaatgtgggagagccttcagccagagtgcctctcttattcaacat
gaaagaattcacaccggagaaaagccctatagatgcaatgaatgtgggaaaggctttact
tctatttcacgacttaatagacaccgaataattcatactggagagaaattgtataattgt
aatgaatgtggtaaagccttaagctcccactcaacacttattattcatgagcgaattcat
actggagaaaaaccatgtaaatgtaaagtatgtggaaaagccttcagacagagttccgct
ctcattcaacatcagagaatgcatactggagaaagaccctataagtgtaacgaatgtgac
aaaacattcaggtgtaactcatcgcttagtaatcaccagagaattcatactggagagaaa
ccatatcgatgtttagaatgtgggatgtcttttggccaaagtgcagctcttatacaacat
cagaggattcatacaggagaaaaaccctttaaatgtaatacatgtggaaaaacttttaga
caaagctcatcacttattgcacatcaaagaattcatactggagagaaaccctatgaatgt
aatgcatgtgggaaactctttagccagaggtcatcccttactaatcattataaaattcac
attgaagaggactccttaaaagccgatttgcatgtgtga

KEGG   Homo sapiens (human): 121274
Entry
121274            CDS       T01001                                 
Symbol
ZNF641
Name
(RefSeq) zinc finger protein 641
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    121274 (ZNF641)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    121274 (ZNF641)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    121274 (ZNF641)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 KRAB zf-C2H2_4 HVO_2753_ZBP Yippee-Mis18
Other DBs
NCBI-GeneID: 121274
NCBI-ProteinID: NP_689533
OMIM: 613906
HGNC: 31834
Ensembl: ENSG00000167528
Pharos: Q96N77(Tdark)
UniProt: Q96N77
LinkDB
Position
12:complement(48334587..48351246)
AA seq 438 aa
MQAEDRSQFGSAAEMLSEQTAALGTGWESMNVQLDGAEPQVERGSQEERPWRTVPGPLEH
LCCDLEEEPQSLQEKAQSAPWVPAIPQEGNTGDWEMAAALLAAGSQGLVTIKDVSLCFSQ
EEWRSLDPSQTDFYGEYVMQENCGIVVSLRFPIPKLDMLSQLEGGEEQWVPDPQDLEERD
ILRVTYTGDGSEHEGDTPELEAEPPRMLSSVSEDTVLWNPEHDESWDSMPSSSRGMLLGP
PFLQEDSFSNLLCSTEMDSLLRPHTCPQCGKQFVWGSHLARHQQTHTGERPYSCLKCEKT
FGRRHHLIRHQKTHLHDKTSRCSECGKNFRCNSHLASHQRVHAEGKSCKGQEVGESPGTR
KRQRAPPVPKCHVCTECGKSFGRRHHLVRHWLTHTGEKPFQCPRCEKSFGRKHHLDRHLL
THQGQSPRNSWDRGTSVF
NT seq 1317 nt   +upstreamnt  +downstreamnt
atgcaagctgaggacaggtcacaatttgggtctgcagcagaaatgctttcagaacagaca
gcagcgctggggacaggatgggaatcaatgaatgtacagctggatggagcagagccccag
gtggaaaggggaagccaggaagagcggccatggagaacagtaccaggacctctggagcac
ctgtgctgtgaccttgaagaggagccacagtcccttcaggagaaggctcagtctgctccc
tgggttcctgcaattccccaggaggggaacactggagactgggagatggcagctgcactt
cttgcggctggatcacagggcctggtaaccatcaaggatgtgtcactgtgcttctctcag
gaggagtggcggagcctggacccctctcagacagacttttatggagaatatgtcatgcag
gaaaactgtgggatagtagtctctctgagatttccaattcccaaactggacatgctttct
caactagaaggaggagaagaacaatgggtccctgacccccaggacttagaggagagggac
attctgagggtcacatatacaggagatggaagtgaacatgagggggatacccctgaacta
gaagcagaacctcccagaatgttatccagcgtgtctgaagatactgttctctggaacccg
gagcatgatgagagctgggattccatgcccagcagctccagaggaatgctcctggggccc
ccttttcttcaggaagatagtttctcaaacctgctgtgtagcacagagatggattccctg
ttaagaccccacacatgcccccagtgtgggaaacagtttgtatggggttcccaccttgcc
aggcatcaacaaacacacactggggagagaccctacagctgcctcaagtgtgagaagacc
tttgggcgaagacatcacctcatcaggcaccagaaaacccacctacatgacaagaccagc
aggtgctctgagtgtggtaagaatttccgatgcaactcccatctggccagccaccagaga
gtgcatgcagaaggcaaatcctgcaaaggccaagaggttggagagagccctggcacaagg
aaacggcagcgtgccccaccagtgccaaagtgtcacgtgtgcactgaatgtgggaagagc
tttggccgaaggcaccaccttgtgagacactggctgacccacactggggagaagcccttc
cagtgccctcgctgtgagaagagctttggccgaaaacatcacctggacaggcacctgctc
acccaccagggacaaagtccccggaacagctgggacagaggaacatctgtcttttga

KEGG   Homo sapiens (human): 125893
Entry
125893            CDS       T01001                                 
Symbol
ZNF816, ZNF816A
Name
(RefSeq) zinc finger protein 816
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    125893 (ZNF816)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    125893 (ZNF816)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    125893 (ZNF816)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 KRAB Zn-ribbon_8 zf-C2H2_11 zf-C2H2_6 zf-C2H2_jaz zf-met zinc_ribbon_15 BolA zf-H2C2_5 Zn_ribbon_SprT zf-C2HC_2 HVO_2753_ZBP
Other DBs
NCBI-GeneID: 125893
NCBI-ProteinID: NP_001026835
HGNC: 26995
Ensembl: ENSG00000180257
Pharos: Q0VGE8(Tdark)
UniProt: Q0VGE8 A0A024R4J0
LinkDB
Position
19:complement(52949385..52962881)
AA seq 651 aa
MLREEATKKSKEKEPGMALPQGRLTFRDVAIEFSLEEWKCLNPAQRALYRAVMLENYRNL
EFVDSSLKSMMEFSSTRHSITGEVIHTGTLQRHKSHHIGDFCFPEMKKDIHHFEFQWQEV
ERNGHEAPMTKIKKLTGSTDRSDHRHAGNKPIKDQLGLSFHSHLPELHMFQTKGKISNQL
DKSIGASSASESQRISCRLKTHISNKYGKNFLHSSFTQIQEICMREKPCQSNECGKAFNY
SSLLRRHHITHSREREYKCDVCGKIFNQKQYIVYHHRCHTGEKTYKCNECGKTFTQMSSL
VCHRRLHTGEKPYKCNECGKTFSEKSSLRCHRRLHTGEKPYKCNECGKTFGRNSALVIHK
AIHTGEKPYKCNECGKTFSQKSSLQCHHILHTGEKPYKCEECDNVYIRRSHLERHRKIHT
GEGSYKCKVCDKVFRSDSYLAEHQRVHTGEKPYKCNKCGRSFSRKSSLQYHHTLHTGEKP
YTCNECGKVFSRRENLARHHRLHAGEKPYKCEECDKVFSRRSHLERHRRIHTGEKPYKCK
VCDKAFRSDSCLANHTRVHTGEKPYKCNKCAKVFNQKGILAQHQRVHTGEKPYKCNECGK
VFNQKASLAKHQRVHTAEKPYKCNECGKAFTGQSTLIHHQAIHGCRETLQM
NT seq 1956 nt   +upstreamnt  +downstreamnt
atgttacgtgaggaagccaccaagaagagcaaagaaaaggagccagggatggctcttcct
cagggacgcttgactttcagggatgtggctatagagttctctttggaggagtggaaatgc
ctgaaccctgcacagagggctttatacagggctgtgatgttggagaactacaggaacctg
gagtttgtggatagctctttaaaatccatgatggagttctcatcaaccaggcacagtatt
acaggagaagtgatccacacagggacgttgcaaagacataaaagtcatcacattggagat
ttttgcttcccagaaatgaagaaagatattcatcactttgagtttcagtggcaagaagtt
gaaagaaatggccatgaagcacccatgacaaaaatcaaaaagttgactggtagtacagac
cgaagtgatcacaggcatgctggaaacaagcctattaaagatcagcttggattaagcttt
cattcgcatctgcctgaactccacatgtttcagactaaagggaaaattagtaaccaattg
gacaagtctatcggtgcttcctcagcttcagaatcccaaagaatttcttgtaggctcaaa
actcatatttctaataagtatgggaagaatttcctccattcttcattcacacaaatacag
gaaatatgcatgagagaaaaaccttgccaaagtaatgagtgtggcaaagcctttaattat
agctcactcttaaggagacaccacataacccattcaagagagagagaatataaatgtgat
gtatgtggcaagatctttaatcagaagcaatacattgtatatcatcatagatgtcacact
ggtgagaaaacttacaagtgtaatgagtgtgggaagaccttcactcagatgtcatccctt
gtatgccatcgtagacttcatactggagagaaaccttacaagtgtaatgagtgtggcaag
accttcagtgagaagtcatcccttagatgccatcgtagacttcatactggagagaaacct
tacaagtgtaatgagtgtggcaagacttttggtcgaaattcagcccttgtaattcataag
gcaattcatactggagagaaaccttacaagtgtaatgagtgtggcaagaccttcagtcag
aaatcatcccttcaatgccatcatatacttcacactggagagaaaccttacaaatgtgaa
gaatgtgacaatgtttacattcgcagatcacaccttgaaagacataggaagattcatact
ggagagggatcatacaaatgtaaggtttgtgacaaggttttccggagtgattcatacctt
gcagaacatcagagagttcatactggagagaaaccatacaagtgtaataaatgtggcagg
agtttcagtcggaagtcatcccttcaataccatcatacacttcacactggagagaaacct
tacacatgtaatgaatgtggcaaggtttttagtcgaagagaaaaccttgcacgtcatcat
agacttcatgctggagagaaaccttacaaatgtgaagaatgtgacaaagttttcagtcgc
agatcacaccttgaaagacataggagaattcatactggggaaaaaccatacaaatgtaag
gtttgtgacaaggctttccggagtgattcatgccttgcaaaccatacgagagttcatact
ggagagaaaccttacaagtgtaataaatgtgcgaaggtttttaatcaaaaaggaatcctt
gcacaacatcagagagttcatactggagagaaaccttacaagtgtaatgaatgtggcaag
gtttttaatcaaaaagcaagccttgcaaaacatcagagagttcatactgcagagaaacct
tacaagtgtaatgagtgtggcaaagcctttactggacagtcaacacttattcaccatcaa
gcaatccatgggtgtagggaaactttacaaatgtaa

KEGG   Homo sapiens (human): 125919
Entry
125919            CDS       T01001                                 
Symbol
ZNF543
Name
(RefSeq) zinc finger protein 543
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    125919 (ZNF543)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    125919 (ZNF543)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    125919 (ZNF543)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 KRAB zf-C2H2_jaz zf-C2H2_6 Zn-ribbon_8 Zn_ribbon_SprT zinc_ribbon_15 zf-met C1_4 zf-AN1 zf_UBZ
Other DBs
NCBI-GeneID: 125919
NCBI-ProteinID: NP_998763
OMIM: 616847
HGNC: 25281
Ensembl: ENSG00000178229
Pharos: Q08ER8(Tdark)
UniProt: Q08ER8
LinkDB
Position
19:57320472..57330770
AA seq 600 aa
MAASAQVSVTFEDVAVTFTQEEWGQLDAAQRTLYQEVMLETCGLLMSLGCPLFKPELIYQ
LDHRQELWMATKDLSQSSYPGDNTKPKTTEPTFSHLALPEEVLLQEQLTQGASKNSQLGQ
SKDQDGPSEMQEVHLKIGIGPQRGKLLEKMSSERDGLGSDDGVCTKITQKQVSTEGDLYE
CDSHGPVTDALIREEKNSYKCEECGKVFKKNALLVQHERIHTQVKPYECTECGKTFSKST
HLLQHLIIHTGEKPYKCMECGKAFNRRSHLTRHQRIHSGEKPYKCSECGKAFTHRSTFVL
HHRSHTGEKPFVCKECGKAFRDRPGFIRHYIIHTGEKPYECIECGKAFNRRSYLTWHQQI
HTGVKPFECNECGKAFCESADLIQHYIIHTGEKPYKCMECGKAFNRRSHLKQHQRIHTGE
KPYECSECGKAFTHCSTFVLHKRTHTGEKPYECKECGKAFSDRADLIRHFSIHTGEKPYE
CVECGKAFNRSSHLTRHQQIHTGEKPYECIQCGKAFCRSANLIRHSIIHTGEKPYECSEC
GKAFNRGSSLTHHQRIHTGRNPTIVTDVGRPFMTAQTSVNIQELLLGKEFLNITTEENLW
NT seq 1803 nt   +upstreamnt  +downstreamnt
atggcagcctcggcgcaggtgtctgtgacctttgaggatgtggctgtgacattcacccag
gaggagtggggacagttggatgcagcccagagaaccttgtatcaggaggtgatgctggag
acctgcggacttctcatgtctctgggctgtcctttgttcaaaccagagctgatctaccag
ttggatcacagacaggagctatggatggctacaaaagacctctcccaaagctcctatcca
ggtgacaacacaaaacccaagaccacagagcctaccttttctcacctggccttgcctgag
gaagtcttactccaggaacaactgacacaaggagcctcaaagaactcccaattagggcaa
tccaaggatcaggatgggccatctgaaatgcaagaagtccacttgaaaatagggataggc
ccccagcgggggaagctgctggagaaaatgagttctgaacgtgatggtttggggtcagat
gatggtgtatgtacaaagattacacagaaacaagtttcaacagaaggtgatctctatgaa
tgtgattcacatggaccagttacagatgccttgattcgcgaagagaaaaattcctataaa
tgtgaggaatgcgggaaagtgtttaaaaagaatgccctccttgttcagcatgaacggatt
cacactcaagtgaagccctatgaatgcacagagtgtgggaaaacctttagcaagagcact
catcttcttcagcacctcatcatccacactggggagaagccctataagtgcatggagtgt
gggaaggcttttaaccgcaggtcacacctcacacggcaccagcggattcacagtggagag
aagccttataagtgcagtgaatgtggaaaggccttcacccaccgctccacttttgtcttg
catcacaggagccacactggagaaaaaccctttgtgtgcaaagagtgtggcaaagccttt
cgagataggccaggtttcattcgacactacatcatccacacgggagagaagccctatgag
tgcattgagtgtgggaaggccttcaaccgccggtcatacctcacgtggcaccaacagatt
cacactggagtgaaaccctttgaatgcaacgagtgtggaaaagctttttgcgagagtgca
gacctcattcaacactacattatccacactggggagaagccctataagtgcatggagtgt
gggaaggcgttcaaccgtaggtcacacctcaagcagcatcaacggattcacactggggag
aagccttatgaatgcagtgaatgtggaaaggccttcacccactgctccacttttgtcttg
cataaaaggacccacacaggagaaaaaccctatgaatgcaaagaatgtggaaaagccttt
agtgatagggcagacctcattcgccacttcagcatccacactggagagaaaccctatgag
tgcgtggagtgtggaaaggccttcaaccgcagctcacacctcacgaggcaccaacagatt
cacactggagagaaaccctatgaatgcatccagtgtgggaaagccttttgccggagcgca
aaccttattcgacactccatcattcacactggagagaagccgtatgaatgcagtgagtgt
ggaaaggcttttaatcgcggctcatccctcacacatcatcaaaggattcatactgggaga
aaccctaccattgtaacagatgtgggaagaccttttatgactgcacagacttcagtcaac
atccaggaacttttattagggaaagagtttttgaatatcaccactgaagaaaatctgtgg
tga

KEGG   Homo sapiens (human): 126017
Entry
126017            CDS       T01001                                 
Symbol
ZNF813
Name
(RefSeq) zinc finger protein 813
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    126017 (ZNF813)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    126017 (ZNF813)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    126017 (ZNF813)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 KRAB zf-C2H2_6 Zn-ribbon_8 zf-C2H2_11 zf-C2H2_jaz zf_UBZ DZR zf-H2C2_5 zinc_ribbon_15 zf-met Zn_ribbon_SprT
Other DBs
NCBI-GeneID: 126017
NCBI-ProteinID: NP_001004301
HGNC: 33257
Ensembl: ENSG00000198346
Pharos: Q6ZN06(Tdark)
UniProt: Q6ZN06
LinkDB
Position
19:53467733..53496255
AA seq 617 aa
MALPQGLLTFRDVAIEFSQEEWKCLDPAQRTLYRDVMLENYRNLVSLDISSKCMMKEFSS
TAQGNREVIHTGTLQRHESHHTGDFRFQEIDKDIHNLEFQWQEDERNSHEAPMTEIKKLT
GSADRYDQRHAGNKPIKDQLGSSFHSHLPELHMFQTQGKIGNQVEKSINDASSISTSQRI
SCRPKTHISNNYGNNFRNSSLLTQKQEVHMREKSFQCNESGKAFNYSSLLRKHQIIHLGE
KQYKCDVCGKVFNRKRNLVCHRRCHTGEKPYRCNECGKTFSQTYSLTCHRRLHTGEKPYK
CEECDKAFSFKSNLKRHRRIHAGEKPYKCNECGKTFSQTSSLTCHRRLHTGEKPFKCNEC
GKTFSRKSSLTCHHRLHTGEKPYKCNECGKTFSQELTLKCHRRLHTGEKPYKCNECGKVF
NKKANLARHHRLHSGEKPYKCTECVKTFSRNSALVIHKAIHIGEKRYKCNECGKTFSRIS
ALVIHTAIHTGEKPYKCNECGKGFNRKTHLACHHRLHTGEKPYKCNECGKVFNRKTHLAH
HHRLHTGDKPYKCNECGKVFNQKAHLARHHRLHTGEKPYKCNECGKVFNQKANLARHHRL
HTGEKPYKFNECGKAFN
NT seq 1854 nt   +upstreamnt  +downstreamnt
atggctcttcctcagggtctattgacattcagggatgtggccatagaattctctcaggag
gagtggaaatgcctggaccctgctcagaggactctatacagggacgtgatgctggagaat
tataggaacctggtctccctggatatctcttccaaatgcatgatgaaggagttctcatca
acagcacaaggcaatagagaagtgatccacacagggacattgcaaagacatgaaagtcat
cacactggagactttcgctttcaggaaattgataaagatattcataacttagagtttcag
tggcaagaagatgaaagaaatagccatgaagcacccatgacagaaatcaaaaagttgact
ggtagtgcagaccgatatgatcaaaggcatgctggaaacaagcctattaaagatcagctt
ggatcaagctttcattcgcatctgcctgaactccacatgtttcagacccaagggaaaatt
ggtaatcaagtggagaagtctatcaacgatgcttcctcaatttcaacatcccaaagaatt
tcttgtaggcccaaaacccatatttctaataactatgggaataatttccggaattcttcg
ttactcacacaaaaacaggaggtacacatgagagaaaagtctttccaatgtaatgagagt
ggcaaagcctttaattatagctcactcttaaggaaacatcaaataatccatttaggagag
aaacaatataaatgtgatgtatgtggcaaggtctttaatcggaagcgaaacctagtgtgc
catcgtagatgtcacactggggagaaaccttacaggtgtaatgagtgtggcaagactttc
agtcagacgtattcccttacatgccatcgtagacttcatactggagagaaaccttacaaa
tgtgaagaatgtgacaaagctttcagtttcaaatcaaaccttaaaagacataggagaatt
catgctggagaaaaaccatacaagtgtaatgaatgtggcaagacctttagtcagacgtca
tcccttacatgccatcgtagacttcatactggagagaaacctttcaagtgtaatgagtgt
ggcaagacctttagtcggaagtcatcccttacatgccatcatagacttcatacgggagag
aaaccttataagtgtaatgaatgtggcaagaccttcagtcaggagttaacccttaaatgc
catcgtagacttcataccggagagaagccttacaagtgtaatgaatgtggcaaggttttt
aataaaaaggcaaaccttgcacgtcatcatagacttcatagtggagagaaaccctacaag
tgtactgagtgtgtcaagacgttcagtcgaaattcagcccttgtaattcataaggctatt
catattggagagaaacgttacaagtgtaatgagtgtggcaagacgttcagtcgaatttca
gccctcgtaattcatacggcaattcatactggagagaaaccttacaagtgtaatgaatgt
ggcaagggttttaatcggaaaacacaccttgcatgtcatcatagacttcatactggagag
aaaccttacaagtgtaatgaatgtggcaaggtttttaatcgaaaaacacaccttgcacat
catcatagacttcatactggagataaaccttacaagtgtaatgaatgtggcaaggttttt
aatcaaaaagcacaccttgcacgtcaccatagacttcatactggagagaaaccttacaag
tgtaatgaatgtggcaaggtttttaatcaaaaagcaaaccttgcacgtcatcatagactt
catactggagagaaaccttacaagtttaatgagtgtggcaaagcttttaattga

KEGG   Homo sapiens (human): 126068
Entry
126068            CDS       T01001                                 
Symbol
ZNF441
Name
(RefSeq) zinc finger protein 441
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    126068 (ZNF441)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    126068 (ZNF441)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    126068 (ZNF441)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2_4 zf-C2H2 KRAB zf-C2H2_6 zf-C2H2_jaz Zn-ribbon_8 Zn_ribbon_SprT zf-met DUF5830 MASE2 XPA_N
Other DBs
NCBI-GeneID: 126068
NCBI-ProteinID: NP_689568
HGNC: 20875
Ensembl: ENSG00000197044
Pharos: Q8N8Z8(Tdark)
UniProt: Q8N8Z8
LinkDB
Position
19:11767000..11784078
AA seq 693 aa
MDSVAFEDVAINFTCEEWALLGPSQKSLYRDVMQETIRNLDCIGMIWQNHDIEEDQYKDL
RRNLRCHMVERACEIKDNSQCGGPFTQTQDSIVNEKIPGVDPWESSECTDVLMGRSSLNC
YVRVDSEHKPCEYQEYGEKPYTHTQCGTAFSYQPCFQIHERPQHGKKLYDCKECASFSSL
ENLQRHMAAHHGDGPRICKLCGNAFIWPSLFHMLRRTHTEEKPYEYEQCSTAFPAYSSTL
RHERTHSGEKPYQCKQCGKAFSCSCYTQLYERTHTGEQSYECKQCGKAFYHLGSFQRHMI
VHTGDGPHKCKICGKGFLSPSSVRRHKRTHTGEKPYECKYCGKAFSDCTGFRRHMITHTG
DGPHKCKVCGKAFDSPSLCRRHETTHTGEKPYKCECGKAFSDFYYFRNHETTHTGEKPYK
CKQCGKAFICCTYLQIHERIHTGERPYKCKQCGKAFRSSNYIRVHEKTHTGEKPYECKQC
GKALSHLKSFQRHMIMHTGDGPHKCKICGKSFDSPSSFRRHERIHTGERPYKCKLCGKGF
RSSSYIQLHERTHTGEKPYGCQQCGKALSDLSSFRRHMITHTGNGPHKCKICGKGFDYPS
SVQRHERTHTGEKPYECKECGKAFSHSSYLRIHERVHTGEKPYKCKECGKPFHCPSAFHK
HERTHSMEKPYKCKECGEAFHCISSFHKHEMTH
NT seq 2082 nt   +upstreamnt  +downstreamnt
atggactcagtggcatttgaggatgtggctataaacttcacctgtgaggagtgggctttg
ctgggtccatcacagaagagtctctacagagatgtgatgcaggaaaccatcagaaacctg
gactgtataggaatgatatggcaaaatcatgatatagaagaagatcagtacaaagatctc
agaagaaatctaagatgtcatatggtagagagagcctgtgaaattaaagataatagtcaa
tgtggaggaccctttacccagactcaagacagtattgtgaacgagaaaatacctggagta
gatccatgggaaagcagtgagtgtacagacgtcctcatgggtcgttcatctcttaattgc
tacgttagagttgacagtgaacacaaaccatgtgagtatcaagaatatggagagaagcca
tatacacatacacaatgtgggacagctttcagttatcagccctgctttcaaatacatgaa
agacctcagcatggaaagaaactctatgattgtaaggaatgtgcaagcttcagttctctt
gaaaaccttcaaagacacatggcagcacaccatggagatggacctcgtatatgtaagttg
tgtggaaacgcctttatttggcctagtttatttcatatgcttagaagaactcacactgaa
gagaaaccatatgaatatgagcagtgttctacagcgtttcctgcttatagttccactcta
agacatgaaagaacacacagtggagagaaaccctatcaatgtaaacaatgtgggaaagcc
ttcagttgttcctgttacactcaactatatgaaaggactcacactggagaacaatcctat
gaatgtaagcaatgtgggaaagcattttatcatcttggaagctttcaaagacacatgata
gtgcacactggagatgggcctcataaatgtaagatatgtggaaaaggctttctttctccc
agttcagttcgaagacataaaagaactcacactggagagaaaccgtatgaatgtaagtat
tgtgggaaagcattctctgattgcacaggttttcgaagacacatgataacgcacactgga
gatggacctcataaatgcaaggtatgtgggaaagcctttgattctcccagtttatgtcga
aggcatgaaacaactcatactggggagaaaccctataaatgtgaatgtgggaaagccttt
agtgatttctattactttcgaaatcatgaaactactcacactggagagaagccatataaa
tgtaaacaatgtggaaaagccttcatttgttgcacttaccttcaaatacatgaaagaatt
cacactggggagagaccctataaatgtaaacaatgcggaaaagccttcaggtcttccaat
tacattcgagtacatgaaaagactcacactggagaaaagccctatgaatgtaagcagtgt
ggaaaagcactttctcatctgaaaagctttcagagacacatgataatgcacactggagat
ggacctcataaatgtaagatatgtgggaaaagctttgattctcccagttcatttcgaaga
catgaaagaattcacactggggagagaccctataagtgtaaactatgtgggaaaggcttc
aggtcttccagttacattcaactacatgaaaggactcacactggagagaaaccctatggt
tgtcagcaatgtgggaaagcattatctgatctctcaagctttcgaagacacatgataaca
catactggaaatggacctcataaatgtaagatatgtgggaaaggctttgattatcccagt
tcagtgcaaagacatgaaagaactcacactggagagaaaccctatgaatgcaaggaatgt
ggtaaagccttcagtcattcaagttacttacgaatacacgaaagagttcatactggagag
aagccgtataaatgtaaggaatgtgggaaaccattccattgtcccagtgcctttcataaa
catgaaaggacccacagtatggagaaaccctataagtgtaaagaatgtggggaagcattt
cattgtatcagttcctttcataaacatgaaatgactcactag

KEGG   Homo sapiens (human): 126070
Entry
126070            CDS       T01001                                 
Symbol
ZNF440
Name
(RefSeq) zinc finger protein 440
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    126070 (ZNF440)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    126070 (ZNF440)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    126070 (ZNF440)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2_4 zf-C2H2 KRAB zf-C2H2_6 zf-C2H2_jaz Zn_ribbon_SprT zf-met zf-C2H2_11 Zn-ribbon_8
Other DBs
NCBI-GeneID: 126070
NCBI-ProteinID: NP_689570
HGNC: 20874
Ensembl: ENSG00000171295
Pharos: Q8IYI8(Tdark)
UniProt: Q8IYI8
LinkDB
Position
19:11814273..11835216
AA seq 595 aa
MDPVAFKDVAVNFTQEEWALLDISQRKLYREVMLETFRNLTSLGKRWKDQNIEYEHQNPR
RNFRSLIEEKVNEIKDDSHCGETFTPVPDDRLNFQEKKASPEVKSCESFVCGEVGLGNSS
FNMNIRGDIGHKAYEYQEYGPKPCKCQQPKKAFRYRPSFRTQERDHTGEKPNACKVCGKT
FISHSSVRRHMVMHSGDGPYKCKFCGKAFHCLRLYLIHERIHTGEKPCECKQCGKSFSYS
ATHRIHKRTHTGEKPYEYQECGKAFHSPRSYRRHERIHMGEKAYQCKECGKAFTCPRYVR
IHERTHSRKNLYECKQCGKALSSLTSFQTHVRLHSGERPYECKICGKDFCSVNSFQRHEK
IHSGEKPYKCKQCGKAFPHSSSLRYHERTHTGEKPYECKQCGKAFRSASHLRVHGRTHTG
EKPYECKECGKAFRYVNNLQSHERTQTHIRIHSGERRYKCKICGKGFYCPKSFQRHEKTH
TGEKLYECKQRSVVPSVVPVPFDIMKGLTLERSPINASNVGKPSELCQSFECMVGLTLKR
NPMSVSNDGKPSDLPHTFEYVVGHTMERSPMHVRNVGNPSDLPRTFEFMKGHKHT
NT seq 1788 nt   +upstreamnt  +downstreamnt
atggacccagtggcttttaaggatgtggctgtgaacttcacccaggaggagtgggctttg
ctggatatttcccagaggaaactctacagggaagtgatgctggaaactttcaggaacctg
acctctttaggaaaaaggtggaaagaccagaacattgaatatgagcaccaaaaccccagg
agaaacttcaggagtctcatagaagaaaaagtcaatgaaattaaagatgacagtcattgt
ggagaaacttttaccccagttccagatgacagactgaacttccaggagaagaaagcttct
cctgaagtaaaatcatgtgaaagctttgtgtgtggagaagttggcctaggtaactcatct
tttaatatgaacatcagaggtgacattggacacaaggcatatgagtatcaggaatatgga
ccaaagccatgtaagtgtcaacaacctaaaaaagccttcagataccgcccctcctttaga
acacaagaaagggatcacactggagagaaacccaatgcttgtaaagtatgtggaaaaacc
tttatttcccattcaagtgttcgaagacacatggtaatgcacagtggggatggaccttat
aaatgtaagttttgtgggaaagcattccattgtctcagattatatcttatccatgaaaga
attcacactggagagaaaccatgtgaatgtaaacagtgtggtaaatcctttagttattct
gctacccatcgaatacataaaagaactcacactggagaaaagccttatgaatatcaggag
tgtgggaaagcatttcatagtcccagatcctatcgtagacatgaaaggattcacatggga
gaaaaggcttatcaatgtaaggaatgtggaaaagcattcacgtgtccccgttatgttcgt
atacatgaaaggacccactctaggaaaaatctctatgaatgtaagcagtgtgggaaagca
ttatcctctcttacaagttttcaaacacacgtaagattgcactctggagaaagaccttat
gaatgtaagatatgtggaaaagacttttgttctgtgaattcatttcaaagacatgaaaaa
attcacagtggagagaaaccctataaatgtaagcagtgtggtaaagccttccctcattcc
agttcccttcgatatcatgaaaggactcacactggagagaaaccctatgagtgtaagcaa
tgtgggaaagccttcagatctgcctcacaccttcgagtgcatggtaggactcacactgga
gagaaaccgtatgaatgtaaggaatgtgggaaagccttcagatatgtgaataaccttcaa
agtcatgaaaggacacaaacacacataagaatacactctggagaaagacgttataaatgt
aagatatgtgggaaaggcttttattgtcccaaatcatttcaaagacatgaaaaaactcac
actggagagaaactctatgaatgcaagcaacgttcagtagttccttcagtagttccagtt
ccttttgatatcatgaaaggactcacactggagagaagccctataaatgcgagcaatgtg
ggaaagccttcagagctgtgtcaatcctttgaatgcatggtaggactcaccctgaagaga
aaccctatgagtgtgagcaatgacggaaagccttcagatctgccccacacctttgaatac
gtggtaggacacacaatggagagaagccctatgcatgtaaggaatgtgggaaacccttcg
gatctgcccagaaccttcgaattcatgaaaggacacaaacacacataa

KEGG   Homo sapiens (human): 126231
Entry
126231            CDS       T01001                                 
Symbol
ZNF573
Name
(RefSeq) zinc finger protein 573
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    126231 (ZNF573)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    126231 (ZNF573)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    126231 (ZNF573)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_6 KRAB zf-C2H2_jaz Zn-ribbon_8 zf_UBZ zinc_ribbon_15 zf-C2H2_11 C1_4 DUF5830 Zn_ribbon_SprT
Other DBs
NCBI-GeneID: 126231
NCBI-ProteinID: NP_001166161
HGNC: 26420
Ensembl: ENSG00000189144
Pharos: Q86YE8(Tdark)
UniProt: Q86YE8
LinkDB
Position
19:complement(37738302..37779586)
AA seq 665 aa
MFPVLEPHQVGLIRSYNSKTMTCFQELVTFRDVAIDFSRQEWEYLDPNQRDLYRDVMLEN
YRNLVSLGGHSISKPVVVDLLERGKEPWMILREETQFTDLDLQCEIISYIEVPTYETDIS
STQLQSIYKREKLYECKKCQKKFSSGYQLILHHRFHVIERPYECKECGKNFRSGYQLTLH
QRFHTGEKPYECTECGKNFRSGYQLTVHQRFHTGEKTYECRQCGKAFIYASHIVQHERIH
TGGKPYECQECGRAFSQGGHLRIHQRVHTGEKPYKCKECGKTFSRRSNLVEHGQFHTDEK
PYICEKCGKAFRRGHQLTVHQRVHTGKKPYECKECGKGYTTASYFLLHQRIHKGGKPYEC
KECKKTFTLYRNLTRHQNIHTGEKLFECKQCGKTYTTGSKLFQHQKTHTGEKPYECKECG
KAFSLYGYLKQHQKIHTGMKHFECKECKKTFTLYRNLTRHQNIHTGKKLFECQECGKAYS
TGSNLIQHRKTHTGEKPYKCKECGKTFSLHGYLNQHQKIHTGMKPYECKVCRKTFTFYRN
LTLHQSIHTDEKPFECKECGKTFRRSSHLTAHQSIHADKKPYECKECGKAFKMYGYLTQH
QKIHTGGKPYECKECGKAFSRASNLVQHERIHTGEKPYVCKQCGKTFRYGSALKAHQRIH
RSIKV
NT seq 1998 nt   +upstreamnt  +downstreamnt
atgtttccagtattggaaccccaccaagtaggactgatcaggtcttacaattctaaaacc
atgacctgttttcaggaattagtgacattcagggatgtggccatagacttctctcggcag
gagtgggaatacctggaccctaatcagagggacttatacagggatgtgatgttggagaac
tatagaaacctggtatcactgggaggacattccatttctaaaccagttgtggttgattta
ctggagcgaggaaaagagccctggatgattttgagggaagaaacacagttcacagatttg
gatttacagtgtgagataatcagctacatagaagtacccacttatgaaacagatatatcc
tctacacaacttcagagcatatataagagagagaaactctatgaatgtaagaaatgtcag
aagaaatttagtagtggttatcaacttattctacatcacaggtttcatgtcattgagaga
ccctatgaatgcaaagagtgtgggaagaactttcgtagtggctatcaacttactctacat
caaagatttcatactggtgagaaaccctatgaatgtacagaatgtgggaagaactttaga
agtggttatcagctgactgtgcatcagagatttcatactggtgagaaaacctatgaatgt
aggcagtgtgggaaggcctttatatatgcctcacacattgttcaacatgagagaattcac
actggtgggaagccgtatgaatgtcaggagtgtgggagggcctttagtcaaggtggacat
cttagaattcatcagagagttcatactggcgaaaaaccatataaatgtaaggaatgtggg
aagacttttagtaggcgctcaaatcttgttgaacatgggcagtttcatactgatgagaag
ccatacatatgtgagaaatgtggaaaggcctttagaagaggtcaccagcttactgtacat
cagagagttcacactggtaaaaagccatatgagtgtaaagaatgtgggaagggctatacc
actgcctcatactttcttctacatcagagaattcataaaggtggaaaaccctatgaatgt
aaggagtgtaagaaaacctttactttgtatagaaatcttactcggcatcagaatattcat
actggtgagaaactttttgaatgcaagcaatgtgggaagacctatactactggttcaaaa
ctctttcaacatcagaaaactcatactggcgagaaaccctatgaatgcaaggaatgcgga
aaggcctttagcttgtatggctaccttaaacaacatcagaaaattcatactggcatgaaa
cactttgaatgtaaggagtgtaaaaaaacctttactttgtatagaaatcttactcgacat
cagaatattcacactggtaagaaactttttgaatgtcaggaatgtgggaaggcctatagt
actggctcaaaccttattcaacatcggaaaactcatactggtgagaaaccctataaatgt
aaggaatgtggcaagacctttagcttgcatggatatcttaatcaacatcagaaaattcat
actggtatgaaaccctatgaatgtaaggtatgtagaaaaacctttactttctatagaaat
cttactctacatcaaagtattcatactgatgagaaaccttttgaatgtaaggaatgtggg
aagacctttagacgtagttcacaccttactgcacatcagagcattcatgctgataaaaaa
ccctatgaatgtaaagaatgtggaaaggcctttaaaatgtatggctaccttacccaacat
cagaaaattcatactggtggaaaaccttatgaatgtaaagaatgtgggaaggccttcagt
cgtgcttcaaaccttgttcaacatgagagaattcatactggtgagaaaccctatgtgtgt
aagcagtgtgggaaaaccttcagatatggttcagcccttaaagcccatcagagaattcat
aggagcataaaagtgtaa

KEGG   Homo sapiens (human): 126295
Entry
126295            CDS       T01001                                 
Symbol
ZNF57, ZNF424
Name
(RefSeq) zinc finger protein 57
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    126295 (ZNF57)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    126295 (ZNF57)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    126295 (ZNF57)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_jaz KRAB zf-C2H2_11 Zn-ribbon_8 zf-trcl Zn_ribbon_SprT zf-C2H2_6 zinc_ribbon_15 C1_1 zf-H2C2_5 Desulfoferrod_N zf-C2HE TerY_C DUF2321 zf-RING_7
Other DBs
NCBI-GeneID: 126295
NCBI-ProteinID: NP_775751
HGNC: 13125
Ensembl: ENSG00000171970
Pharos: Q68EA5(Tdark)
UniProt: Q68EA5 A5HJR3
LinkDB
Position
19:2900928..2918473
AA seq 555 aa
MDSVVFEDVAVDFTLEEWALLDSAQRDLYRDVMLETFRNLASVDDGTQFKANGSVSLQDM
YGQEKSKEQTIPNFTGNNSCAYTLEKNCEGYGTEDHHKNLRNHMVDRFCTHNEGNQYGEA
IHQMPDLTLHKKVSAGEKPYECTKCRTVFTHLSSLKRHVKSHCGRKAPPGEECKQACICP
SHLHSHGRTDTEEKPYKCQACGQTFQHPRYLSHHVKTHTAEKTYKCEQCRMAFNGFASFT
RHVRTHTKDRPYKCQECGRAFIYPSTFQRHMTTHTGEKPYKCQHCGKAFTYPQAFQRHEK
THTGEKPYECKQCGKTFSWSETLRVHMRIHTGDKLYKCEHCGKAFTSSRSFQGHLRTHTG
EKPYECKQCGKAFTWSSTFREHVRIHTQEQLYKCEQCGKAFTSSRSFRGHLRTHTGEKPY
ECKQCGKTFTWSSTFREHVRIHTQEQLHKCEHCGKAFTSSRAFQGHLRMHTGEKPYECKQ
CGKTFTWSSTLHNHVRMHTGEKPHKCKQCGMSFKWHSSFRNHLRMHTGQKSHECQSYSKA
FSCQVILSKTSESTH
NT seq 1668 nt   +upstreamnt  +downstreamnt
atggactcagtggtctttgaggatgtggctgtggacttcaccctggaggagtgggctttg
ctggattctgctcagagggacctctacagagatgtgatgctggagaccttccggaacctg
gcctcagtagatgatgggactcaatttaaagccaatgggtcagtttctctgcaggatatg
tacgggcaagaaaaatctaaggaacagacaataccaaacttcacaggaaataattcctgt
gcctacactttagaaaaaaattgtgaaggctatggcactgaagaccaccacaaaaatctg
agaaatcatatggtggacagattctgtacacataatgaaggtaatcaatatggagaagcc
atccatcaaatgccagatcttaccctgcacaagaaagtttctgctggagaaaaaccatat
gaatgcaccaagtgcaggacagtcttcacgcatctttcttctcttaaaaggcacgtcaag
tctcactgtggacgaaaagcacctccaggtgaggaatgtaagcaggcctgcatttgtccc
tcacacctacacagtcacggaagaactgacactgaggagaagccgtataagtgtcaagca
tgtgggcaaactttccaacatcctcgttacctctcccaccacgtaaagactcacacagca
gagaaaacctacaaatgcgagcagtgtcggatggcgtttaatgggttcgcaagcttcact
agacatgtgagaactcacacaaaagacaggccatataaatgtcaggaatgtgggagagcc
ttcatttatccctcgacatttcaaagacacatgacaacacacactggagagaagccctat
aaatgtcagcactgtgggaaagccttcacttacccccaggcttttcaaagacatgagaag
acgcacacgggagagaagccctatgaatgcaagcagtgtgggaaaacattcagttggtct
gaaaccttgcgagtccacatgaggatccacactggggacaaactctataaatgtgaacac
tgtgggaaggcttttacctcttccagatcattccaaggtcatttgaggacgcacactgga
gagaaaccttatgagtgtaaacaatgtgggaaagccttcacttggtcctcaacgtttaga
gaacatgtgagaattcacacgcaagagcagctctataaatgtgaacaatgtgggaaggct
tttacctcttccagatcattccgaggtcatttgaggacgcacactggagagaagccttat
gagtgtaaacaatgtggaaaaaccttcacttggtcctcaacgtttagagaacatgtgaga
attcacacgcaagagcagctccataaatgtgaacactgtgggaaggcctttacctcttcc
agagcattccaaggtcatttgaggatgcacactggagagaagccttatgagtgtaaacaa
tgtggaaaaaccttcacttggtcctcaaccttacataatcatgtgaggatgcacactgga
gagaaacctcacaaatgtaaacaatgtgggatgtccttcaagtggcactcctccttccgg
aaccatctgaggatgcacacaggacagaaatcccacgaatgtcagtcatactcaaaagcc
ttcagttgccaagtcattctttctaaaaccagtgagagcacacactaa

KEGG   Homo sapiens (human): 126375
Entry
126375            CDS       T01001                                 
Symbol
ZNF792
Name
(RefSeq) zinc finger protein 792
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    126375 (ZNF792)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    126375 (ZNF792)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    126375 (ZNF792)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 KRAB zf-C2H2_6 zf-C2H2_jaz zf-C2H2_11 C1_1 zinc_ribbon_15 zf-H2C2_5 Zn-ribbon_8
Other DBs
NCBI-GeneID: 126375
NCBI-ProteinID: NP_787068
HGNC: 24751
Ensembl: ENSG00000180884
Pharos: Q3KQV3(Tdark)
UniProt: Q3KQV3
LinkDB
Position
19:complement(34956354..34964229)
AA seq 632 aa
MAAAALRDPAQGCVTFEDVTIYFSQEEWVLLDEAQRLLYCDVMLENFALIASLGLISFRS
HIVSQLEMGKEPWVPDSVDMTSAMARGAYGRPGSDFCHGTEGKDLPSEHNVSVEGVAQDR
SPEATLCPQKTCPCDICGLRLKDILHLAEHQTTHPRQKPFVCEAYVKGSEFSANLPRKQV
QQNVHNPIRTEEGQASPVKTCRDHTSDQLSTCREGGKDFVATAGFLQCEVTPSDGEPHEA
TEGVVDFHIALRHNKCCESGDAFNNKSTLVQHQRIHSRERPYECSKCGIFFTYAADLTQH
QKVHNRGKPYECCECGKFFSQHSSLVKHRRVHTGESPHVCGDCGKFFSRSSNLIQHKRVH
TGEKPYECSDCGKFFSQRSNLIHHKRVHTGRSAHECSECGKSFNCNSSLIKHWRVHTGER
PYKCNECGKFFSHIASLIQHQIVHTGERPHGCGECGKAFSRSSDLMKHQRVHTGERPYEC
NECGKLFSQSSSLNSHRRLHTGERPYQCSECGKFFNQSSSLNNHRRLHTGERPYECSECG
KTFRQRSNLRQHLKVHKPDRPYECSECGKAFNQRPTLIRHQKIHIRERSMENVLLPCSQH
TPEISSENRPYQGAVNYKLKLVHPSTHPGEVP
NT seq 1899 nt   +upstreamnt  +downstreamnt
atggcagcggcggcgctgcgggaccccgcgcagggctgcgtgacctttgaggacgtgacc
atttacttctcccaggaggagtgggtgctcctcgatgaggctcagagactcctgtactgc
gatgtgatgctggaaaactttgcacttatagcctcgctgggacttatatctttcaggtcc
cacatcgtttcccagttggagatggggaaagagccctgggtgcctgacagtgtggatatg
acatcagccatggccagaggggcttatggcaggcctggctctgatttttgccatggaaca
gagggcaaggacttaccttctgagcataacgtttctgtagaaggagtggcacaggacagg
agtcccgaggcaactctgtgcccccagaagacctgcccctgtgacatatgtggcctacgt
ttgaaagacattttgcatttggctgaacaccagacaacacatcccaggcagaaaccattt
gtgtgtgaggcatatgtgaaaggctctgagttcagtgcaaaccttccccggaaacaggtg
cagcagaacgtacacaaccctatcagaacggaggagggccaggcttcccctgtaaagacc
tgcagagaccacacatcagatcagctttccacctgcagggagggtgggaaggactttgtg
gccacagcagggtttctgcagtgtgaggtcactcccagcgatggggagccgcacgaggcc
accgaaggtgtggtggattttcacattgcactaaggcataacaagtgctgtgaatctggg
gatgccttcaataacaaatccactcttgttcagcaccagagaatccacagcagagaaagg
ccttatgaatgcagcaaatgtggaatcttcttcacttacgccgctgacctcactcaacac
cagaaagttcacaatagaggaaaaccgtatgagtgctgtgaatgtggaaaattcttcagc
cagcactccagccttgttaaacatcgcagggttcacaccggtgaaagccctcacgtgtgt
ggtgactgtgggaaattcttcagccgaagctccaacctcattcagcataagagggttcac
actggtgaaaagccatatgagtgcagcgactgtgggaagttcttcagccagcgttccaac
ctcattcatcataagagggttcatacgggcagaagtgcccatgagtgcagtgaatgtggg
aaatctttcaactgcaactccagcctaattaaacattggagagttcacactggagaaaga
ccttacaagtgtaacgaatgtgggaaattcttcagccacattgccagcctcattcaacat
cagatagttcacactggcgagcggcctcacgggtgtggtgagtgtgggaaagccttcagc
cgaagctctgacctcatgaaacatcagcgagttcacactggtgagcggccttatgaatgc
aatgaatgtgggaagttatttagccagagctccagcctcaatagccatcggagacttcac
actggtgaacggccttaccagtgcagtgaatgtgggaaattctttaaccaaagctccagc
ctcaataaccaccggagacttcacaccggcgagcggccttatgagtgcagcgaatgtggg
aaaaccttcaggcagaggtccaatctgaggcagcacctgaaagttcacaaaccagacagg
ccttacgaatgcagcgaatgtgggaaagccttcaaccaaaggcctaccctcattcggcat
cagaagattcacatcagagaaaggagcatggagaatgtgctccttccctgttcacagcac
acaccagagataagctctgagaacagaccttatcagggcgctgtcaactacaagttgaaa
cttgttcatccaagtacccaccctggggaggttccctag

KEGG   Homo sapiens (human): 127396
Entry
127396            CDS       T01001                                 
Symbol
ZNF684
Name
(RefSeq) zinc finger protein 684
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    127396 (ZNF684)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    127396 (ZNF684)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    127396 (ZNF684)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 KRAB Zn-ribbon_8 zf-C2H2_jaz zf-C2H2_6 DZR zinc_ribbon_15 HVO_2753_ZBP C1_4 HypA MCM_OB zf-C2H2_8 Zn_Tnp_IS1595 zf-C2H2_3rep Zn_ribbon_SprT
Other DBs
NCBI-GeneID: 127396
NCBI-ProteinID: NP_689586
HGNC: 28418
Ensembl: ENSG00000117010
Pharos: Q5T5D7(Tdark)
UniProt: Q5T5D7 B3KSP5
LinkDB
Position
1:40531637..40548167
AA seq 378 aa
MISFQESVTFQDVAVDFTAEEWQLLDCAERTLYWDVMLENYRNLISVGCPITKTKVILKV
EQGQEPWMVEGANPHESSPESDYPLVDEPGKHRESKDNFLKSVLLTFNKILTMERIHHYN
MSTSLNPMRKKSYKSFEKCLPPNLDLLKYNRSYTVENAYECSECGKAFKKKFHFIRHEKN
HTRKKPFECNDCGKAYSRKAHLATHQKIHNGERPFVCNDCGKAFMHKAQLVVHQRLHTGE
KPYECSQCGKTFTWNSSFNQHVKSHTLEKSFECKECGKTFRYSSSLYKHSRFHTGEKPYQ
CIICGKAFGNTSVLVTHQRIHTGEKPYSCIECGKAFIKKSHLLRHQITHTGEKPYECNRC
GKAFSQKSNLIVHQKIHT
NT seq 1137 nt   +upstreamnt  +downstreamnt
atgatcagcttccaggaatcagtgacattccaggatgtggctgtggatttcactgcagag
gagtggcagctgcttgattgtgctgagagaaccctgtattgggatgtgatgttggagaac
tatagaaacctcatctcagtgggatgtccaattaccaaaacaaaagtgatcctcaaggta
gagcaaggacaagagccatggatggtggagggagcgaatccacacgagagctctccagaa
tctgactacccacttgttgatgaaccagggaagcatcgggaaagcaaagacaattttttg
aagtcagttttgctcacattcaataaaattctgactatggagagaatccaccattataat
atgagcacaagtcttaatccaatgagaaaaaaatcatataaatcgtttgagaagtgtttg
ccacctaatttagacttacttaaatataatagaagttatactgtagaaaacgcttatgaa
tgcagtgaatgcgggaaagccttcaaaaagaagtttcatttcattagacatgaaaaaaat
catacaaggaaaaaaccttttgaatgcaatgactgtggaaaagcctatagcaggaaggca
caccttgcaactcatcagaaaattcataatggagagagaccctttgtgtgcaatgattgt
gggaaggcgtttatgcataaagcccaactcgtggtccaccagagacttcacactggagag
aagccttatgagtgcagtcaatgtgggaaaacattcacttggaactcctcatttaatcaa
cacgtgaaatctcatacacttgagaagtcatttgaatgtaaggaatgtgggaaaaccttc
aggtatagttcatccctttataaacattccagatttcatacaggagagaaaccctaccag
tgtatcatatgtggcaaagcttttggcaacacatccgtgcttgttacacaccaaagaatt
catacaggagagaaaccttacagttgtattgaatgtggcaaagccttcatcaagaagtcc
catctcctcagacatcagataactcatacaggagagaagccctatgaatgtaacagatgt
gggaaagcattttcccagaagtcaaatcttattgtacatcagaaaattcatacataa

KEGG   Homo sapiens (human): 136051
Entry
136051            CDS       T01001                                 
Symbol
ZNF786
Name
(RefSeq) zinc finger protein 786
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    136051 (ZNF786)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    136051 (ZNF786)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    136051 (ZNF786)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 KRAB Zn-ribbon_8 HypA C1_4 zf-met zf-C2H2_11 CpXC zf-Di19 zinc_ribbon_4
Other DBs
NCBI-GeneID: 136051
NCBI-ProteinID: NP_689624
HGNC: 21806
Ensembl: ENSG00000197362
Pharos: Q8N393(Tdark)
UniProt: Q8N393
LinkDB
Position
7:complement(149069641..149090718)
AA seq 782 aa
MAEPPRLPLTFEDVAIYFSEQEWQDLEAWQKELYKHVMRSNYETLVSLDDGLPKPELISW
IEHGGEPFRKWRESQKSGNIICSSVDMHFDPGFEEQLFWGSQQAMNSGKTKSHFQLDPES
QCSFGSFVSFRPDQGITLGSPQRHDARAPPPLACGPSESTLKEGIPGPRNLDLPGLWDVP
AWESTQHPWPVCGESCWENNHLVMHQRGHSKDRTRRAWEKFNKRAETQMPWSSPRVQRHF
RCGVCGKSFRRKLCLLRHLAAHTGRGPFRNADGEMCFRHELTHPSHRLPQQGEKPAQCTP
CGKRSLPVDSTQARRCQHSREGPASWREGRGASSSVHSGQKPGSRLPQEGNSHQEGDTEA
LQHGAEGPCSCSECGERSPMSARLASPCRAHTGEKPFQCAHCTKRFRLRRLLQVHQHAHG
GERPFSCRKCGKGFAKQCKLTEHIRVHSGEKPFRCAKCGRNFRQRGQLLRHQRLHTDEKP
FQCPECGLSFRLESMLRAHRLRHGGERPFSCSECGRGFTHQCKLREHLRVHSGERPFQCL
KCDKRFRLKGILKAHQHTHSKERPFSCGECGKGFTRQSKLTEHLRVHSGERPFQCPECNR
SFRLKGQLLSHQRLHTGERPFQCPECDKRYRVKADMKAHQLLHSGEMPFSCECGKGFVKH
SKLIEHIRTHTGEKPFQCPKCDKSFRLKAQLLSHQGLHTGERPFHCPECDKNFRERGHML
RHQRIHRPERPFACGDCGKGFIYKSKLAEHIRVHTKSCPAPNELDIKKRLSQLFAMIEAD
WS
NT seq 2349 nt   +upstreamnt  +downstreamnt
atggcggagccgcctcggctacctctgacttttgaggatgttgctatttatttctccgag
caagaatggcaggatctagaggcatggcagaaggaactttacaagcatgtgatgagaagc
aattatgagactctcgtctctctagatgatggacttccaaaaccagaactaatatcctgg
attgaacacgggggagagcccttcaggaaatggagagaatcacagaaatcaggaaacata
atttgctcctctgttgatatgcattttgatccaggttttgaggaacagctgttttgggga
agccagcaggctatgaattcaggaaaaactaaaagccatttccaattagatcctgaaagc
cagtgttcctttggatcctttgtttccttcaggcctgaccaaggcatcaccctcgggagc
ccacagagacacgacgccagggctcctccaccactagcctgcggccccagtgaatctacc
ctaaaagaaggaatcccaggtcccagaaatctggatcttcctggtttgtgggacgtcccc
gcctgggagagcacccagcacccttggcctgtctgcggggaaagctgttgggagaacaac
catttagtaatgcaccagagaggccactcaaaggaccggacacgtagggcctgggagaaa
ttcaacaagagggcggagacgcagatgccgtggagcagccctcgggtacagaggcacttc
cggtgtggcgtgtgcggtaagagcttccgccggaagctgtgtctgctgcgccatctggcg
gcccacacggggaggggccccttccggaacgctgacggtgaaatgtgcttccgacacgag
ctgacccatcccagccaccgcctcccgcagcagggggagaagcctgcccagtgcacccca
tgcggcaagcgctccctcccagtggacagcacgcaggctcgccggtgccagcacagccgg
gaggggccggcctcttggagagaaggccgcggggcctccagcagtgtgcactcgggacag
aaaccaggctcgcgcctgccccaggaggggaacagccaccaggaaggggacacggaggcg
ctgcagcatggcgcagaggggccctgctcctgctcggagtgtggcgagcgctcccctatg
agcgccaggctcgccagcccctgcagggcgcatactggagaaaagcccttccagtgtgcg
cattgcaccaagcgcttccgcctgcgccgcctgctgcaggtccaccagcacgcgcacggt
ggggagagaccgttctcctgcaggaagtgtggcaagggcttcgccaagcagtgtaaactc
acggagcacattcgagtccacagcggagagaagcctttccggtgtgccaagtgtggcagg
aacttccgtcagaggggacagctgctgcggcaccagcggctgcacacggacgagaagccc
tttcagtgcccagagtgtgggctgagcttccgcctggagagcatgctgagagcccaccgg
ctccggcacggtggggagaggccgttctcctgtagcgagtgtggcagaggcttcacccac
cagtgcaagctccgtgagcacctgagagtgcacagcggggagaggcccttccagtgcctg
aagtgcgacaagcgcttccgcctgaagggcatcctgaaggcccaccagcacacgcacagc
aaggagaggccgttctcgtgcggggagtgtggcaagggcttcaccagacaatccaagctc
acggagcacttgcgcgtgcacagcggggagagacccttccagtgcccagagtgcaacagg
agcttccgcctgaaggggcagctgctcagccatcagcgcctgcacacgggagagaggccc
ttccagtgtccggagtgcgacaagcgctatcgcgtgaaggccgacatgaaggcccaccag
ctgctgcacagcggggagatgcctttctcctgtgagtgcggcaagggctttgtgaaacac
tcaaagctcatcgagcacatcagaacgcacacgggagagaagccttttcagtgtcccaag
tgtgacaagagtttccgcctgaaggcgcagctgctcagccatcagggcctgcacacaggg
gagaggccttttcactgccctgagtgtgacaagaacttccgggaaaggggacacatgctg
aggcaccagcgcatccacaggcccgagaggccctttgcctgtggcgattgtgggaagggc
ttcatttacaagtctaagcttgcggagcacatcagagtacacacaaaatcctgtcctgct
ccaaatgaactggacattaagaaaaggctcagccaactgtttgcaatgatagaggccgat
tggagttga

KEGG   Homo sapiens (human): 139735
Entry
139735            CDS       T01001                                 
Symbol
ZFP92, ZNF897
Name
(RefSeq) ZFP92 zinc finger protein
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    139735 (ZFP92)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    139735 (ZFP92)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    139735 (ZFP92)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 KRAB zf-C2H2_6 zf-C2H2_jaz Zn-ribbon_8 zf_UBZ Zn_ribbon_SprT zinc_ribbon_15 zf-Di19 HVO_2753_ZBP zf-met zf-C2H2_8 zf-BED
Other DBs
NCBI-GeneID: 139735
NCBI-ProteinID: NP_001129745
HGNC: 12865
Ensembl: ENSG00000189420
Pharos: A6NM28(Tdark)
UniProt: A6NM28
LinkDB
Position
X:153411472..153426481
AA seq 416 aa
MAAILLTTRPKVPVSFEDVSVYFTKTEWKLLDLRQKVLYKRVMLENYSHLVSLGFSFSKP
HLISQLERGEGPWVADIPRTWATAGLHIGDRTQSKTSTSTQKHSGRQLPGADPQGGKEGQ
AARSSVLQRGAQGLGQSSAAGPQGPKGAEKRYLCQQCGKAFSRSSNLIKHRIIHSGEKPY
ACPECGKLFRRSFALLEHQRIHSGEKPYACPECSKTFTRSSNLIKHQVIHSGERPFACGD
CGKLFRRSFALLEHARVHSGERPYACPECGKAFSRSSNLIEHQRTHRGEKPYACGQCAKA
FKGVSQLIHHQRSHSGERPFACRECGKAFRGRSGLSQHRRVHSGEKPYECSDCGKAFGRR
ANLFKHQAVHGARRPAKAETARRLAGPGSTGPGSAVAATSPPRPSTAARPSRPSRR
NT seq 1251 nt   +upstreamnt  +downstreamnt
atggcagccattctcctgaccacgagacccaaggtgccagtatcttttgaggatgtgtcc
gtgtacttcacaaagacagaatggaagcttctggacctcagacaaaaggtcctctacaag
cgggtgatgctggagaactatagccatttggtgtcactgggattttccttctccaagcct
cacctgatctcccaattggaacgaggggaaggaccctgggtagcagacatccccagaacc
tgggccaccgcaggattgcacataggtgacagaacacagagcaagacgtcgacttcaacg
cagaagcattctggacgacaactccccggggccgatccacaaggtggcaaggaggggcag
gcggcgaggtcgtctgtgctccagagaggtgcccagggcttggggcagagttcggctgcg
gggccgcagggccccaaaggcgcggagaagcggtacctgtgccagcagtgtgggaaggcc
ttcagccgcagctccaacctcatcaagcaccgcatcatccacagtggcgagaagccttac
gcgtgccccgagtgcggcaagctgtttcgccgcagcttcgcgctcctggagcaccagcgc
atccacagcggcgagaagccctacgcctgccccgagtgcagcaagaccttcacgcgcagc
tccaacctcatcaagcaccaggtcatccacagcggcgagcggcccttcgcctgcggcgac
tgcggcaaactgttccgccgcagcttcgcgctcctggagcacgcgcgcgtgcacagcggc
gagcggccctacgcgtgcccagagtgcggcaaggccttcagccgcagctccaacctcatc
gagcaccagcgcacgcaccgcggcgagaagccctacgcctgcggccagtgcgccaaggcc
ttcaagggcgtctcgcagctcatccaccaccagcgcagccacagcggcgagcggcccttc
gcgtgccgcgagtgcggcaaggccttccgtggccgttcgggcctcagccagcaccggcgc
gtgcacagcggtgagaagccctacgagtgcagcgactgcggcaaggccttcggccggcgc
gccaacctattcaagcaccaggcagtgcacggcgccaggcgccctgcgaaggcggagacg
gcgcggaggctagcgggccctgggagcaccggccctgggagcgcggtggcggccaccagc
cccccgcggccgagcacagccgccaggccttccaggcccagccgccgctga

KEGG   Homo sapiens (human): 140612
Entry
140612            CDS       T01001                                 
Symbol
ZFP28, mkr5
Name
(RefSeq) ZFP28 zinc finger protein
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    140612 (ZFP28)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    140612 (ZFP28)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    140612 (ZFP28)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 KRAB zf-C2H2_4 zf-C2H2_jaz zf-C2H2_6 Zn-ribbon_8 zf-C2H2_11 zinc_ribbon_15 C1_4 BolA zf_UBZ
Other DBs
NCBI-GeneID: 140612
NCBI-ProteinID: NP_065879
OMIM: 616798
HGNC: 17801
Ensembl: ENSG00000196867
Pharos: Q8NHY6(Tdark)
UniProt: Q8NHY6
Structure
LinkDB
Position
19:56536947..56556808
AA seq 868 aa
MRGAASASVREPTPLPGRGAPRTKPRAGRGPTVGTPATLALPARGRPRSRNGLASKGQRG
AAPTGPGHRALPSRDTALPQERNKKLEAVGTGIEPKAMSQGLVTFGDVAVDFSQEEWEWL
NPIQRNLYRKVMLENYRNLASLGLCVSKPDVISSLEQGKEPWTVKRKMTRAWCPDLKAVW
KIKELPLKKDFCEGKLSQAVITERLTSYNLEYSLLGEHWDYDALFETQPGLVTIKNLAVD
FRQQLHPAQKNFCKNGIWENNSDLGSAGHCVAKPDLVSLLEQEKEPWMVKRELTGSLFSG
QRSVHETQELFPKQDSYAEGVTDRTSNTKLDCSSFRENWDSDYVFGRKLAVGQETQFRQE
PITHNKTLSKERERTYNKSGRWFYLDDSEEKVHNRDSIKNFQKSSVVIKQTGIYAGKKLF
KCNECKKTFTQSSSLTVHQRIHTGEKPYKCNECGKAFSDGSSFARHQRCHTGKKPYECIE
CGKAFIQNTSLIRHWRYYHTGEKPFDCIDCGKAFSDHIGLNQHRRIHTGEKPYKCDVCHK
SFRYGSSLTVHQRIHTGEKPYECDVCRKAFSHHASLTQHQRVHSGEKPFKCKECGKAFRQ
NIHLASHLRIHTGEKPFECAECGKSFSISSQLATHQRIHTGEKPYECKVCSKAFTQKAHL
AQHQKTHTGEKPYECKECGKAFSQTTHLIQHQRVHTGEKPYKCMECGKAFGDNSSCTQHQ
RLHTGQRPYECIECGKAFKTKSSLICHRRSHTGEKPYECSVCGKAFSHRQSLSVHQRIHS
GKKPYECKECRKTFIQIGHLNQHKRVHTGERSYNYKKSRKVFRQTAHLAHHQRIHTGESS
TCPSLPSTSNPVDLFPKFLWNPSSLPSP
NT seq 2607 nt   +upstreamnt  +downstreamnt
atgcggggggcggcgagcgcgagtgtccgcgagccgacgccgctcccgggtagaggcgcc
ccccgcacaaagccccgggcgggccgaggcccgactgtagggactccagccaccttggcc
ctccctgcccggggaaggccgcgctcaaggaatggcctcgcatccaaaggccagcgagga
gcggcccctacggggcctgggcacagagctctgccttccagggacactgctcttccccag
gagagaaacaagaagctggaggctgtggggacaggaattgaacctaaagccatgtcccag
ggcttggtgacatttggggatgtggctgtagatttctcccaagaggagtgggagtggctg
aaccccattcagaggaacttgtacaggaaggtgatgttggagaactacaggaacctggca
tcgctgggactttgtgtttctaagcccgatgtgatctcctcgttggaacaaggaaaagag
ccttggacagtgaagcgaaagatgacaagagcctggtgcccagacttgaaggctgtgtgg
aagatcaaggagttacctctcaagaaggacttctgcgaaggaaagctatcccaggcagtg
ataacagagagactcacaagctataatctggagtactctctgttaggggaacactgggat
tatgatgctctgtttgagacacagccgggcttggtgactatcaaaaacctggctgttgac
ttccgccagcagctacacccagctcagaagaatttctgtaagaatgggatatgggagaac
aacagtgacctgggatcagcaggacattgtgtggctaagccagatttagtctctttacta
gagcaagagaaggagccctggatggtgaagcgagagctgacaggaagcctgttctcaggc
cagcgatctgtacatgagacccaggaattatttccaaagcaagattcatatgctgaaggg
gtaacagacagaacctcaaacactaaacttgattgttccagtttcagagaaaattgggat
tctgactatgtgtttggaaggaagcttgcagtaggtcaagagacacaattcaggcaagag
ccaattactcataacaaaaccctctctaaggaaagagaacgtacatataacaaatctgga
agatggttctatttggacgattcagaagagaaagttcataatcgtgattcaattaaaaat
tttcaaaaaagttcagtggtaataaaacaaacaggcatctatgcaggaaaaaagcttttc
aagtgtaatgaatgtaagaaaacttttacccagagctcatctcttactgttcatcagaga
attcacactggagagaaaccttataaatgtaatgaatgtgggaaggcctttagtgacggc
tcatcctttgcccgacaccagagatgtcacactggcaagaagccctatgagtgcattgag
tgtgggaaagctttcatacagaacacatcccttatccgtcactggagatactatcatact
ggggagaaaccctttgattgcatcgattgtgggaaagccttcagtgaccacatagggctt
aatcaacacaggagaattcatactggagagaaaccttacaaatgtgatgtatgtcacaaa
tccttcaggtatggttcctcccttactgtacatcaaaggattcataccggagaaaaacca
tatgaatgtgatgtttgcagaaaagccttcagccatcatgcatcactcactcaacatcaa
agagtacattctggagaaaagccttttaagtgtaaagagtgcggaaaagcttttaggcag
aatatacaccttgccagtcatttaaggattcatactggggagaagccttttgaatgtgcg
gagtgtggaaaatccttcagcatcagttctcagcttgccactcatcagagaatccatact
ggagagaagccctatgaatgtaaggtttgtagtaaagcgttcacccagaaggctcacctt
gcacagcatcagaaaacccatacaggagagaaaccatatgagtgcaaggaatgcggtaaa
gccttcagccagaccacacacctcattcaacatcagagagttcacactggtgagaaaccc
tataaatgtatggaatgtgggaaggcctttggtgataactcatcctgtactcaacatcaa
agactgcacactggccaaagaccttatgaatgtattgagtgtggaaaggcattcaagaca
aaatcctcccttatttgtcatcgcagaagtcatactggagaaaaaccttatgaatgcagt
gtgtgtggcaaagcctttagtcatcgtcaatcccttagtgtacatcagagaatccattct
ggaaagaaaccatatgaatgtaaggaatgtaggaaaaccttcatccaaattggacacctt
aatcaacataagagagttcatactggagagagatcttataactataagaaaagcagaaaa
gtcttcaggcaaactgctcacttagctcatcatcagcgaattcatactggagagtcgtca
acatgcccctctttaccttccacgtcaaatcctgtggatctgtttcccaaatttctctgg
aatccatcctccctcccatcaccatag

KEGG   Homo sapiens (human): 146198
Entry
146198            CDS       T01001                                 
Symbol
ZFP90, FIK, NK10, ZNF756, zfp-90
Name
(RefSeq) ZFP90 zinc finger protein
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    146198 (ZFP90)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    146198 (ZFP90)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    146198 (ZFP90)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 KRAB zf-C2H2_6 zf-C2H2_jaz Zn-ribbon_8 zf-C2H2_11 zinc_ribbon_15 zf-C2HC_2 zf-LYAR
Other DBs
NCBI-GeneID: 146198
NCBI-ProteinID: NP_001292132
OMIM: 609451
HGNC: 23329
Ensembl: ENSG00000184939
Pharos: Q8TF47(Tdark)
UniProt: Q8TF47
LinkDB
Position
16:68533479..68576506
AA seq 636 aa
MAPRPPTAAPQESVTFKDVSVDFTQEEWYHVDPAQRSLYRDVMLENYSHLVSLGYQVSKP
EVIFKLEQGEEPWISEGEIQRPFYPDWKTRPEVKSSHLQQDVSEVSHCTHDLLHATLEDS
WDVSSQLDRQQENWKRHLGSEASTQKKIITPQENFEQNKFGENSRLNTNLVTQLNIPARI
RPSECETLGSNLGHNADLLNENNILAKKKPYKCDKCRKAFIHRSSLTKHEKTHKGEGAFP
NGTDQGIYPGKKHHECTDCGKTFLWKTQLTEHQRIHTGEKPFECNVCGKAFRHSSSLGQH
ENAHTGEKPYQCSLCGKAFQRSSSLVQHQRIHTGEKPYRCNLCGRSFRHGTSLTQHEVTH
SGEKPFQCKECGKAFSRCSSLVQHERTHTGEKPFECSICGRAFGQSPSLYKHMRIHKRGK
PYQSSNYSIDFKHSTSLTQDESTLTEVKSYHCNDCGEDFSHITDFTDHQRIHTAENPYDC
EQAFSQQAISHPGEKPYQCNVCGKAFKRSTSFIEHHRIHTGEKPYECNECGEAFSRRSSL
TQHERTHTGEKPYECIDCGKAFSQSSSLIQHERTHTGEKPYECNECGRAFRKKTNLHDHQ
RIHTGEKPYSCKECGKNFSRSSALTKHQRIHTRNKL
NT seq 1911 nt   +upstreamnt  +downstreamnt
atggccccgaggcctccgaccgccgcgccccaggaatcagtgacattcaaagatgtgtct
gtggacttcacccaggaagaatggtaccatgtcgaccctgctcagaggagcttatacagg
gatgtgatgctggagaactatagccacctggtttctcttggatatcaagtttccaagcca
gaggtgatcttcaaattggagcaaggagaagagccatggatatcagagggagaaatccaa
cgacctttctatccagactggaagaccaggcctgaagtcaaatcatcacatttgcagcag
gatgtatcagaagtatcccactgcacacatgatctcttacatgctacattagaagactcc
tgggatgttagcagccagttagacaggcaacaggaaaactggaagagacatctgggatca
gaggcatccacccagaagaaaataattacaccacaagaaaattttgagcaaaataaattt
ggtgaaaattctagattgaacaccaatttggttacacaactgaacattcctgcaagaata
aggcctagtgaatgtgagacccttggaagcaatttgggacataatgcagacttacttaat
gagaataatattcttgcaaaaaagaaaccctataagtgtgataaatgtagaaaagccttt
attcatagatcatcgcttactaaacatgagaaaacacataaaggagagggagctttccct
aatggaacagatcaaggaatttatcctggaaagaaacaccatgaatgtaccgactgtggg
aaaacctttctctggaagacacagcttactgagcatcagagaattcacactggggagaaa
ccctttgaatgcaatgtatgtggaaaggccttcaggcatagctcatctcttggtcagcat
gagaatgctcataccggagagaaaccctatcagtgtagtctctgtgggaaagccttccag
cgcagctcctcccttgttcaacaccagcgaattcacactggagagaaaccctatcgatgt
aatctatgtgggaggtcctttaggcatggcacatccctcactcaacacgaggtcacacac
agtggagagaagcccttccagtgtaaggaatgtgggaaagcctttagtcgatgttcttcc
cttgtccaacatgagaggactcatactggagagaaaccttttgaatgtagcatatgtggg
agggcttttggtcagagcccatccctttataaacatatgaggattcataagagaggcaaa
ccttaccaaagcagtaactacagcatagatttcaagcacagcacatctctcactcaagat
gaaagcactcttaccgaagtgaaatcctaccattgtaatgactgtggggaagactttagt
cacattacagactttactgaccatcagaggatccatactgcagagaacccctatgattgt
gagcaggcttttagtcagcaagctatttctcatcctggagagaaaccctatcaatgtaat
gtatgtgggaaagctttcaaaaggagtacaagtttcatagagcatcacagaattcatact
ggagagaaaccctatgaatgtaatgagtgtggagaagcctttagtcgacgctcatcgctt
actcaacatgagagaacccacactggagagaaaccctatgaatgtattgactgtgggaaa
gcctttagtcaaagttcatctctcattcagcatgagagaactcatactggagagaagccc
tatgaatgtaatgaatgtgggagagccttccgaaaaaaaaccaacctgcatgatcatcag
agaattcatactggagaaaaaccctattcttgtaaggaatgtgggaaaaacttcagccga
agttcagctcttactaaacaccagagaattcatactcgaaataaactctag

KEGG   Homo sapiens (human): 146434
Entry
146434            CDS       T01001                                 
Symbol
ZNF597, HIT-4
Name
(RefSeq) zinc finger protein 597
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    146434 (ZNF597)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    146434 (ZNF597)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    146434 (ZNF597)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 KRAB zf-C2H2_6 zf-C2H2_jaz FYVE zf-C2H2_8 zf-met Zn-ribbon_8 zinc_ribbon_15 CPxCG_zf GAGA
Other DBs
NCBI-GeneID: 146434
NCBI-ProteinID: NP_689670
OMIM: 614685
HGNC: 26573
Ensembl: ENSG00000167981
Pharos: Q96LX8(Tdark)
UniProt: Q96LX8
LinkDB
Position
16:complement(3432414..3443504)
AA seq 424 aa
MASMPPTPEAQGPILFEDLAVYFSQEECVTLHPAQRSLSKDGTKESLEDAALMGEEGKPE
INQQLSLESMELDELALEKYPIAAPLVPYPEKSSEDGVGNPEAKILSGTPTYKRRVISLL
VTIENHTPLVELSEYLGTNTLSEILDSPWEGAKNVYKCPECDQNFSDHSYLVLHQKIHSG
EKKHKCGDCGKIFNHRANLRTHRRIHTGEKPYKCAKCSASFRQHSHLSRHMNSHVKEKPY
TCSICGRGFMWLPGLAQHQKSHSAENTYESTNCDKHFNEKPNLALPEETFVSGPQYQHTK
CMKSFRQSLYPALSEKSHDEDSERCSDDGDNFFSFSKFKPLQCPDCDMTFPCFSELISHQ
NIHTEERPHKCKTCEESFALDSELACHQKSHMLAEPFKCTVCGKTFKSNLHLITHKRTHI
KNTT
NT seq 1275 nt   +upstreamnt  +downstreamnt
atggcgtccatgcccccgacgcccgaggcccagggaccaatactctttgaggatctggct
gtgtatttttctcaagaggagtgcgtgactctgcaccctgcccagaggtccctcagcaaa
gatggtacaaaagagtctttggaggatgcggctttgatgggagaggaaggcaagcctgag
attaatcagcagttaagcctagagtctatggaacttgacgagcttgccttagaaaagtac
cccattgctgcaccccttgtcccttacccagaaaaatcctctgaggatggagttggaaac
cctgaagcgaaaatattaagtggaactcccacttacaagagaagggtcatcagcctttta
gttaccattgaaaaccacaccccattagtagaactctctgaatatttaggaaccaacaca
ctttctgaaattcttgattctccctgggaaggagccaaaaatgtgtacaaatgtcctgag
tgtgaccaaaacttcagcgatcattcatacctagttttgcatcagaaaattcattcagga
gagaaaaaacataaatgtggtgactgtggaaagatcttcaatcatagagccaacctgagg
acacacaggagaatccatactggtgagaaaccttataagtgtgccaagtgcagtgccagc
tttcgccagcactctcatctatcccgacacatgaatagccacgtaaaggagaagccctat
acatgtagcatatgtggtagaggttttatgtggctcccaggattggcacagcatcagaaa
agccacagtgctgaaaacacctacgaatctactaactgtgataaacattttaatgagaaa
ccaaatcttgctttgcctgaggaaacattcgtatcaggcccccagtaccagcacactaag
tgcatgaagagcttcaggcagtccttatatcctgccctttccgagaagagccacgacgag
gactctgaacgctgcagcgatgatggggacaatttcttctcattctcaaaattcaagccc
ttacagtgtcctgactgtgacatgacctttccttgtttctctgagcttatttcccatcag
aacattcatacagaggaaaggccccataagtgcaaaacatgcgaggaaagttttgctttg
gactcagaacttgcatgccaccagaagagccacatgctagcggaaccttttaaatgtacc
gtgtgtgggaaaactttcaagtcgaatttgcatctcattactcataagcgaactcacata
aaaaacaccacgtaa

KEGG   Homo sapiens (human): 146540
Entry
146540            CDS       T01001                                 
Symbol
ZNF785, ZNF688
Name
(RefSeq) zinc finger protein 785
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    146540 (ZNF785)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    146540 (ZNF785)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    146540 (ZNF785)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 KRAB Zn-ribbon_8 Zn_ribbon_SprT zf-C2H2_jaz zf-C2H2_6 zf-DNA_Pol zf-C2H2_8
Other DBs
NCBI-GeneID: 146540
NCBI-ProteinID: NP_689671
HGNC: 26496
Ensembl: ENSG00000197162
Pharos: A8K8V0(Tdark)
UniProt: A8K8V0 A0A024QZC7
LinkDB
Position
16:complement(30578361..30585697)
AA seq 405 aa
MGPPLAPRPAHVPGEAGPRRTRESRPGAVSFADVAVYFSPEEWECLRPAQRALYRDVMRE
TFGHLGALGFSVPKPAFISWVEGEVEAWSPEAQDPDGESSAAFSRGQGQEAGSRDGNEEK
ERLKKCPKQKEVAHEVAVKEWWPSVACPEFCNPRQSPMNPWLKDTLTRRLPHSCPDCGRN
FSYPSLLASHQRVHSGERPFSCGQCQARFSQRRYLLQHQFIHTGEKPYPCPDCGRRFRQR
GSLAIHRRAHTGEKPYACSDCKSRFTYPYLLAIHQRKHTGEKPYSCPDCSLRFAYTSLLA
IHRRIHTGEKPYPCPDCGRRFTYSSLLLSHRRIHSDSRPFPCVECGKGFKRKTALEAHRW
IHRSCSERRAWQQAVVGRSEPIPVLGGKDPPVHFRHFPDIFQECG
NT seq 1218 nt   +upstreamnt  +downstreamnt
atggggccgcccctggcgccgcgcccggcccacgtacccggggaggccgggccccggagg
acgagggaaagcaggccgggcgccgtgagcttcgcggacgtggccgtgtacttctctccc
gaggagtgggaatgcctgcggccagcgcagagggccctgtaccgggacgtgatgcgggag
accttcggccacctgggcgcgctgggattttcagttcccaaacccgcttttatctcgtgg
gtggaaggagaagtggaggcgtggagcccggaggcccaggatcccgacggtgagagctct
gcagctttcagcaggggccaaggacaggaagcaggatccagggatgggaatgaggagaag
gaaaggctgaagaagtgtccaaaacaaaaagaggtggcgcatgaagtggctgtcaaggag
tggtggcccagcgtcgcctgcccagagttctgcaaccctaggcagagccccatgaatccc
tggctcaaggacactctgacccgaagactgccccactcttgcccagactgtggccgcaac
ttcagctacccttccctcctggccagccaccagcgggtccactccggggagcggcccttc
tcctgcggccagtgtcaggcgcgtttctcccagcgcaggtacctgctccagcatcagttc
atccacaccggcgagaagccctacccctgccccgactgcgggcgccgcttccgccagagg
ggttccctggctatccacaggcgggctcacaccggggagaagccttacgcgtgctcagac
tgcaagagtcgcttcacttacccctacctgctggccatccaccagcgcaagcacacgggc
gagaagccctacagctgccccgattgcagcctccgtttcgcctacacctccctgctggcc
atccacaggcgcatacacaccggcgagaagccctacccctgtcctgactgcggccgccgc
ttcacctattcttccctcctcctcagtcaccggcgcattcactccgacagccggcccttc
ccctgcgtggagtgtgggaaaggcttcaagcgcaagaccgccctggaagcccatcggtgg
atccaccgctcctgcagcgagaggcgcgcgtggcagcaggccgtggtggggcgttcagag
cccatccctgttttgggaggcaaggatcccccagttcacttccggcactttccagatata
tttcaagagtgtgggtga

KEGG   Homo sapiens (human): 146542
Entry
146542            CDS       T01001                                 
Symbol
ZNF688
Name
(RefSeq) zinc finger protein 688
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    146542 (ZNF688)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    146542 (ZNF688)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    146542 (ZNF688)
SSDB
Motif
Pfam: KRAB zf-C2H2 zf-H2C2_2 zf-C2H2_4 Zn-ribbon_8 Zn_ribbon_SprT
Other DBs
NCBI-GeneID: 146542
NCBI-ProteinID: NP_660314
HGNC: 30489
Ensembl: ENSG00000229809
Pharos: P0C7X2(Tdark)
UniProt: P0C7X2 A0A0S2Z633
LinkDB
Position
16:complement(30569726..30579951)
AA seq 276 aa
MAPPPAPLLAPRPGETRPGCRKPGTVSFADVAVYFSPEEWGCLRPAQRALYRDVMQETYG
HLGALGFPGPKPALISWMEQESEAWSPAAQDPEKGERLGGARRGDVPNRKEEEPEEVPRA
KGPRKAPVKESPEVLVERNPDPAISVAPARAQPPKNAAWDPTTGAQPPAPIPSMDAQAGQ
RRHVCTDCGRRFTYPSLLVSHRRMHSGERPFPCPECGMRFKRKFAVEAHQWIHRSCSGGR
RGRRPGIRAVPRAPVRGDRDPPVLFRHYPDIFEECG
NT seq 831 nt   +upstreamnt  +downstreamnt
atggcgccgcccccagccccgctcctggcgccgaggcccggggagacccggcctggttgc
aggaagcccgggactgtgagcttcgcggacgtggccgtgtacttctccccggaggagtgg
ggctgtctgcggcccgcgcagagggctctgtaccgggacgtgatgcaggagacctacggc
cacctgggcgcgctcggattcccaggccccaaaccagccctcatctcttggatggaacag
gagagtgaggcttggagccccgccgcccaggatcctgagaagggggaaagactgggagga
gctcggagaggagatgtcccaaacaggaaggaagaggaaccggaggaagtcccaagagcc
aaagggcctagaaaggctcctgtgaaggagagtcctgaagtgctggtggaacgcaaccct
gacccagctattagcgtggccccggcacgggcacagccacccaaaaatgctgcctgggac
ccgaccacaggagcacagcccccggcacccatacccagcatggatgctcaggccggccag
cggcgccacgtgtgcacggactgcggccgccgcttcacctacccctcactgctggtcagc
cacaggcgcatgcactcgggggagcggcctttcccctgccccgagtgtggcatgcgcttc
aagaggaagttcgcagtggaagcgcaccagtggatccaccgctcctgctccggggggcgg
cggggccggaggcctgggatccgggctgtgcctcgggcccccgtccgaggtgaccgggac
ccgcctgtgctcttccggcactacccagacatcttcgaggagtgcggctga

KEGG   Homo sapiens (human): 147657
Entry
147657            CDS       T01001                                 
Symbol
ZNF480
Name
(RefSeq) zinc finger protein 480
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    147657 (ZNF480)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    147657 (ZNF480)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    147657 (ZNF480)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 KRAB zf-C2H2_6 Zn-ribbon_8 zf-C2H2_11 C1_1 zf-C2HE DZR zinc_ribbon_15 HypA Desulfoferrod_N zf-met zf-RING_15
Other DBs
NCBI-GeneID: 147657
NCBI-ProteinID: NP_653285
OMIM: 613910
HGNC: 23305
Ensembl: ENSG00000198464
Pharos: Q8WV37(Tdark)
UniProt: Q8WV37 B7Z8E1
LinkDB
Position
19:52297169..52325922
AA seq 535 aa
MLCDEKAQKRRKRKAKESGMALPQGHLTFRDVAIEFSQAEWKCLDPAQRALYKDVMLENY
RNLVSLGISLPDLNINSMLEQRREPWSGESEVKIAKNSDGRECIKGVNTGSSYALGSNAE
DKPIKKQLGVSFHLHLSELELFPDERVINGCNQVENFINHSSSVSCLQEMSSSVKTPIFN
RNDFDDSSFLPQEQKVHLREKPYECNEHSKVFRVSSSLTKHQVIHTVEKPYKCNSCGKVF
SRNSHLAEHCRIHTGEKPYKCNVCGKVFSYNSNFARHQRIHTREKPYECNECGKVFSNNS
YLARHQRIHAEEKPYKCNECGKGFSHKSSLANHWRIYTGEKPYKCDECGKAFYRIALLVR
HQKIHTGEKPYKCNECGKVFIQNSHLAQHWRIHTGEKPYKCNECGKVFNQLSNLARHRRI
HTGEKPYKCNECGKAFSEYSGLSAHLVIHTGEKPYKCSECGKAFRHKLSLTNHQRIHTGE
RPYKCNECGKVFNRIAHLARHRKIHTGEKPYKCNECGKAFSRISYLAQHWTIHMG
NT seq 1608 nt   +upstreamnt  +downstreamnt
atgctgtgtgatgaaaaagcccagaagagaaggaagaggaaagcaaaggagtcagggatg
gctcttcctcagggacacttaacattcagggacgtggccatagaattctctcaggcggag
tggaaatgcctggaccctgcacagagggctttatacaaggatgtgatgttggagaactac
aggaacctggtctccctgggaatctctcttcctgacctgaatattaactccatgttggag
caaaggagggagccctggtctggtgagagtgaagtgaaaatagcaaaaaattcagatggg
agggagtgcatcaaaggtgtgaacacagggagcagctatgcattgggaagcaatgcagaa
gacaaaccaattaaaaaacaacttggagtatcctttcacttacatctgtctgaactggag
ctatttccagatgaaagggtaataaatggatgtaatcaagttgaaaactttatcaaccac
agttcctctgtttcctgtcttcaagaaatgtcttccagtgtcaaaacccccatttttaat
aggaatgattttgatgattcttcatttctcccacaagaacagaaagtacaccttagagaa
aaaccttatgaatgtaatgagcatagcaaagtctttagagtatcttccagccttactaaa
catcaagtaatccatactgtagagaaaccttacaaatgtaattcatgcggcaaggtcttt
agtcgcaattcacaccttgcagaacattgtagaattcatactggagagaaaccttacaaa
tgtaatgtctgtggcaaggtttttagttacaattcaaactttgcacgacatcaaagaatt
cataccagagagaagccgtatgaatgtaatgaatgtggtaaagtcttcagtaataattct
taccttgcacgacatcaaagaattcatgctgaagagaaaccttacaaatgtaatgaatgt
ggtaaaggcttcagtcataagtcatctctagcaaatcattggagaatttatactggagag
aagccttacaaatgtgatgaatgtggcaaggccttctataggattgcgctccttgtacga
catcagaaaattcatactggagagaaaccttacaaatgtaatgaatgtggaaaggtcttt
attcaaaattcgcacctagcacaacattggagaattcatacaggagagaaaccttacaaa
tgtaatgaatgtggaaaagtatttaatcaactttcaaatcttgcacgacatcgaagaatt
catactggagagaagccttacaaatgtaatgaatgtggtaaagcatttagtgagtattca
ggcctttcagcccatcttgtaatccacactggagagaagccttacaaatgtagtgaatgt
ggcaaggcattcagacacaagttatcactaaccaatcatcagagaatccatactggagaa
agaccttacaaatgtaatgaatgtggcaaggtcttcaatcgaattgcacaccttgcacga
catcggaaaattcatactggagagaaaccttacaaatgtaatgagtgtggcaaggccttt
agtcgcatttcatacctagcacaacattggacaattcatatgggatag

KEGG   Homo sapiens (human): 147658
Entry
147658            CDS       T01001                                 
Symbol
ZNF534, KRBO3
Name
(RefSeq) zinc finger protein 534
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    147658 (ZNF534)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    147658 (ZNF534)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    147658 (ZNF534)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 KRAB Zn-ribbon_8 zf-C2H2_6 zf-C2H2_11 C1_1 zinc_ribbon_15 zf_UBZ zf-C2H2_jaz BolA zf-LYAR HVO_2753_ZBP
Other DBs
NCBI-GeneID: 147658
NCBI-ProteinID: NP_001137411
HGNC: 26337
Ensembl: ENSG00000198633
Pharos: Q76KX8(Tdark)
UniProt: Q76KX8
LinkDB
Position
19:52429148..52452263
AA seq 674 aa
MALTQGQLSFSDVAIEFSQEEWKCLDPGQKALYRDVMLENYRNLVSLGEDNVRPEACICS
GICLPDLSVTSMLEQKRDPWTLQSEVKIINNPDGRECIKGVNTEKSSKLGSSAGNKSLKN
QHGLTLQLHLTEWQPFQAVRNIYGCKHVEKSISDNSSVSPVQISFFSVKTHIFNNYRNDF
LFSTLLPQEQKVHIREKPYGCNEHGKVFRVSSSLTNRQVIHIADKTYKCSDCGEIFSSNS
NFAQHQRIHTGEKPYKYNECGKVFNQNSHLAQHQKIHTGQKPYNNKECGKVFSHHAYLAQ
HRKIHTGEKPYKCSECGKAFSVCSSLTAHLVIHTGEKPYDCKECGKVFRHKSSLTTHQTV
HTGERPYKCNECGKGFSRIAFLARHRKVHTGEKPYKCNECGKVFIGNSRLARHRKIHTGG
RRYKCNECGKAFRTCSDLTAHLLIHTGEKPYECIDCGKVFRHKSSLTYHCRIHTGEKPYK
CNECGKVFSQNSNLQRHRKIHTGEKLYKCNECGKVFRQNSHLAQHRDIHTGEKPYSCNEC
GKVFRRNSHLVRHRNVHTGEKPYSCNECGKVFSRNSHLARHRNIHTGEKPHSCNECGKVF
SRNSHLARHRKIHTGEKLYKCNECSKVFSRNSRLAQHRNIHTGVKPYSCNECGKVFSKNS
ILVQHCSIHTREKP
NT seq 2025 nt   +upstreamnt  +downstreamnt
atggcccttactcaggggcaattgtcattcagcgatgtggccatagaattctctcaggag
gagtggaaatgcctggaccctgggcagaaagctttatacagggacgtgatgttagagaac
tacaggaacctggtctccctaggtgaggataatgtccgtccagaagcctgcatctgctct
ggaatctgtcttcctgacctgagtgttacctccatgttggagcaaaagagagatccctgg
actctgcagagtgaagtgaaaataataaacaatccagatggcagggagtgcatcaaaggt
gtgaacacagagaagagttctaaattgggaagcagtgcaggaaacaagtcacttaaaaat
caacatggattaactcttcagttacatctgactgaatggcagccatttcaagctgtaagg
aatatttatggatgtaagcatgttgagaaatctatcagtgacaattcttcagtttcacca
gttcaaataagttttttcagtgtcaaaacccatatttttaataactacagaaatgatttt
cttttttctacattactcccacaagaacagaaagtacacattagggaaaagccttatgga
tgtaatgagcatgggaaagtcttcagagtgtcttcaagccttactaaccgtcaagtaatc
cacattgcagataaaacttacaaatgtagtgactgtggcgagatctttagtagcaattca
aactttgcacaacatcaacgaatccatactggagagaagccttacaaatataatgaatgt
ggcaaagtcttcaatcagaattcacaccttgcacaacatcagaaaattcatactggacag
aaaccttacaataacaaagaatgtgggaaagtctttagtcaccatgcctaccttgcacag
cataggaaaattcatactggagagaagccttacaaatgtagtgaatgtggcaaagcattt
agtgtgtgttccagtcttactgctcatcttgtaatccatactggagagaaaccttatgat
tgtaaggaatgtggcaaggtcttcaggcataagtcttccctaaccactcatcagacagtt
catactggagagagaccatacaaatgtaatgaatgtggcaaggggtttagtcgaattgca
ttccttgcaaggcatcggaaagttcatactggagagaaaccttacaaatgtaatgagtgt
ggcaaggtctttattggcaattcacgccttgcacgacataggaaaattcatactgggggg
aggcgttacaaatgtaatgaatgtggcaaagcatttagaacgtgttcagatctcactgcc
catcttctaatccatactggagagaaaccttacgaatgtatagactgtggcaaggtcttc
aggcacaagtcttccctaacctatcactgtagaattcatactggagagaagccttacaaa
tgtaacgaatgtggcaaggtcttcagtcagaattcaaaccttcaacgacataggaaaatt
catactggagagaagctttacaaatgtaatgaatgtggcaaggtcttccgtcagaattca
caccttgcacaacatagggatattcatactggagagaagccttacagttgtaatgaatgt
ggcaaggtcttccgtcggaattcacaccttgtgcgacataggaatgttcatactggagaa
aagccttacagttgtaatgaatgtggcaaggtcttcagtcggaattcacaccttgcgcga
cataggaatattcatactggagagaagcctcacagttgtaatgaatgtggcaaggtcttc
agtcggaattcacaccttgcgcgacataggaaaattcatactggagagaagctttacaaa
tgtaatgaatgtagcaaggtcttcagtcggaattcacgccttgcacaacataggaatatt
catactggagtgaagccttacagttgtaatgaatgtggcaaggtctttagtaaaaattcc
atcctagtacaacattgcagtattcataccagagagaagccttaa

KEGG   Homo sapiens (human): 147660
Entry
147660            CDS       T01001                                 
Symbol
ZNF578
Name
(RefSeq) zinc finger protein 578
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    147660 (ZNF578)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    147660 (ZNF578)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    147660 (ZNF578)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 KRAB zf-C2H2_4 zf-C2H2_6 zf-H2C2_5 Zn-ribbon_8 zf-C2H2_11 Zn_ribbon_SprT
Other DBs
NCBI-GeneID: 147660
NCBI-ProteinID: NP_001093164
HGNC: 26449
Ensembl: ENSG00000258405
Pharos: Q96N58(Tdark)
UniProt: Q96N58 Q3MI94
LinkDB
Position
19:52453553..52516882
AA seq 590 aa
MLHEEAAQKRKGKEPGMALPQGRLTFRDVAIEFSLAEWKFLNPAQRALYREVMLENYRNL
EAVDISSKRMMKEVLSTGQGNTEVIHTGMLQRHESYHTGDFCFQEIEKDIHDFEFQSQKD
ERNGHEASMPKIKELMGSTDRHDQRHAGNKPIKDQLGLSFHLHLPELHIFQPEEKIANQV
EKSVNDASSISTSQRISCRPETHTPNNYGNNFFHSSLLTQKQEVHMREKSFQCNETGEAF
NCSSFVRKHQIIHLGEKQYKFDICGKVFNEKRYLARHRRCHTSEKPYKCNECGKSFSYKS
SLTCHRRCHTGEKPYKCNECGKSFSYKSSLTCHHRCHTGEKPYKCNECGKSFSYKSSLRC
HRRLHTGIKPYKCNECGKMFGQNSTLVIHKAIHTGEKPYKCNECGKAFNQQSHLSRHHRL
HTGEKPYKCNDCGKAFIHQSSLARHHRLHTGEKSYKCEECDRVFSQKSNLERHKIIHTGE
KPYKCNECHKTFSHRSSLPCHRRLHSGEKPYKCNECGKTFNVQSHLSRHHRLHTGEKPYK
CKVCDKAFMCHSYLANHTRIHSGEKPYKCNECGKAHNHLIDSSIKPCMSS
NT seq 1773 nt   +upstreamnt  +downstreamnt
atgttacatgaggaagcagctcagaagaggaaaggaaaggagccaggcatggctcttcct
cagggacgcttgactttcagggatgtggctatagaattctcattggcagagtggaaattc
ctgaaccctgcgcagagggctttgtacagggaagtgatgttggagaactacaggaacctg
gaggctgtggatatctcttccaaacgcatgatgaaggaggtcttgtcaacagggcaaggc
aatacagaagtgatccacacagggatgttgcaaagacatgaaagttatcacactggagat
ttttgcttccaggaaattgaaaaagatattcatgactttgagtttcagtcacaaaaagat
gaaagaaatggccatgaagcatccatgccaaaaatcaaagagttgatgggtagcacagac
cgacatgatcaaaggcatgctggaaacaagcctattaaagatcagcttggattaagcttt
catttgcatcttcctgaactccacatatttcagcccgaagagaaaattgctaatcaagtg
gagaagtctgtcaacgatgcttcctcaatttcaacatcccaaagaatttcttgtaggcct
gaaacacatactcctaataactatgggaataattttttccattcatcattactcacacaa
aaacaggaagtacacatgagagaaaaatctttccaatgtaatgagactggcgaagccttt
aattgtagctcatttgtaaggaaacatcagataatccatttaggagaaaaacaatataaa
tttgatatatgtggcaaagtctttaatgagaagcgataccttgcacgccatcgtagatgt
cacactagtgagaaaccttacaagtgtaatgaatgtggaaagtccttcagttacaagtca
tccctgacatgccatcgtagatgtcacactggtgagaaaccttacaagtgtaatgaatgt
ggaaagtccttcagttacaagtcatcccttacatgccatcataggtgtcacactggtgag
aaaccttacaagtgtaatgaatgtggaaagtccttcagttacaagtcatcccttagatgc
catcgtagacttcatactggaataaaaccttacaagtgtaatgagtgtggcaagatgttt
ggtcaaaattcaacccttgtaattcataaggcaattcatactggagagaaaccttacaag
tgtaatgaatgtggcaaggcttttaatcaacaatcacacctttcacgtcatcatagactt
catactggagagaaaccttacaagtgtaatgactgtggtaaggcttttattcatcagtca
agccttgcacgtcatcatagacttcatactggagagaaatcttacaaatgtgaagaatgt
gacagagttttcagtcagaaatcaaaccttgagagacacaagataattcatactggagag
aaaccttacaagtgtaatgagtgtcacaagaccttcagtcacaggtcatctcttccatgc
catcgtagacttcatagtggtgagaaaccttacaagtgtaatgaatgtgggaagactttt
aatgtacagtcacacctttcacgtcatcatagacttcatactggagagaaaccttacaaa
tgtaaggtttgtgacaaggctttcatgtgccattcttatctggcaaaccatactagaatt
catagcggagagaaaccttacaagtgtaatgagtgtggtaaggctcacaatcacttgatt
gattcatcaatcaagccttgcatgtcatcatag

KEGG   Homo sapiens (human): 147686
Entry
147686            CDS       T01001                                 
Symbol
ZNF418, ZFP418
Name
(RefSeq) zinc finger protein 418
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    147686 (ZNF418)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    147686 (ZNF418)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    147686 (ZNF418)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_jaz KRAB zf-C2H2_6 zf-met zf_UBZ zf-C2H2_11 C1_1 Zn-ribbon_8
Other DBs
NCBI-GeneID: 147686
NCBI-ProteinID: NP_001303958
OMIM: 619509
HGNC: 20647
Ensembl: ENSG00000196724
Pharos: Q8TF45(Tdark)
UniProt: Q8TF45 B7Z1P3
LinkDB
Position
19:complement(57921882..57935402)
AA seq 676 aa
MQGTVAFEDVAVNFSQEEWSLLSEVQRCLYHDVMLENWVLISSLGCWCGSEDEEAPSKKS
ISIQRVSQVSTPGAGVSPKKAHSCEMCGAILGDILHLADHQGTHHKQKLHRCEAWGNKLY
DSSNRPHQNQYLGEKPYRSSVEEALFVKRCKFHVSEESSIFIQSGKDFLPSSGLLLQEAT
HTGEKSNSKPECESPFQWGDTHYSCGECMKHSSTKHVFVQQQRLPSREECYCWECGKSFS
KYDSVSNHQRVHTGKRPYECGECGKSFSHKGSLVQHQRVHTGKRPYECGECGKSFSHKGS
LVQHQRVHTGERPYECGECGKSFSQNGTLIKHQRVHTGERPYECEECGKCFTQKGNLIQH
QRGHTSERPYECEECGKCFSQKGTLTEHHRVHTRERPYECGECGKSFSRKGHLRNHQRGH
TGERPYECGECGKSFSRKGNLIQHQRSHTGERPYECRECRKLFRGKSHLIEHQRVHTGER
PYECNECGKSFQDSSGFRVHQRVHTGEKPFECSECGKSFPQSCSLLRHRRVHTGERPYEC
GECGKSFHQSSSLLRHQKTHTAERPYECRECGKFFSSLLEHRRVHTGERPYECRECGKTF
TRRSAHFKHQRLHTRGKPYECSECGKSFAETFSLTEHRRVHTGERPYECSECGKSFHRSS
SLLRHQRVHTERSPYK
NT seq 2031 nt   +upstreamnt  +downstreamnt
atgcagggcactgtggcatttgaagatgtggctgtgaacttttcccaggaggagtggagt
ctccttagtgaggttcagagatgcctttaccatgacgtgatgctggagaactgggtactt
atatcctccctgggttgttggtgtggatcagaagatgaggaggcaccttctaagaagagc
atttctatacaaagagtgtctcaggtcagcactcctggggcaggtgtgtctcccaagaag
gcccactcttgtgaaatgtgtggcgcgatcttgggagacattttgcacttggcagatcat
caggggacacatcacaagcagaaactgcacaggtgtgaggcatgggggaataaattgtat
gatagttcaaaccgtccgcaccagaatcagtaccttggagagaaaccctatagaagcagt
gttgaggaagcattgtttgtgaagaggtgtaagttccatgtgtcagaggagtcatctatc
ttcattcagagtggaaaggactttttgcccagctcaggattactgctgcaggaggccact
cacactggggagaagtcaaacagcaaacctgagtgtgagtctccctttcagtggggagat
actcattacagctgtggagaatgcatgaaacattctagcaccaaacacgtatttgttcaa
cagcagagacttccctctagagaggaatgttattgctgggaatgtgggaaatcctttagc
aaatatgatagcgtcagtaatcatcagagagttcacactgggaaaagaccttatgaatgt
ggagaatgtgggaaatcttttagtcataagggcagccttgttcagcatcagcgagttcac
actgggaaaagaccttatgaatgtggagaatgtgggaaatcttttagtcataagggcagc
cttgttcagcatcagcgagttcatactggagaaagaccttatgagtgtggagaatgtggg
aaatcttttagtcaaaatggtactctcattaaacatcaacgagttcacactggagaaaga
ccttatgagtgtgaagaatgtgggaaatgttttactcagaagggcaatctcattcaacat
caacgaggtcacactagtgaaagaccttatgagtgtgaagaatgtggaaaatgttttagt
caaaagggcaccctaactgaacatcatcgagttcacactagagaacgaccttatgagtgt
ggagaatgtgggaaatcttttagtcgaaagggacaccttaggaaccatcagcgaggtcac
actggagaaagaccttacgagtgtggagaatgtgggaaatcttttagtcgaaagggcaac
ctcattcagcatcagcgaagccacactggagaaaggccttatgagtgtagagagtgtagg
aaattatttaggggcaagtcccacctcattgaacaccagagagttcacactggagaaagg
ccatatgaatgtaatgaatgtgggaaatcatttcaagacagctctgggtttcgtgttcat
cagagagttcacactggagaaaaaccgtttgagtgtagtgaatgtgggaagtcatttcct
caaagctgttccctccttcgacatcggagagttcatactggagaaaggccttatgaatgt
ggagaatgtggaaagtcatttcatcagagctcttccctccttcgacatcagaaaactcac
actgcagaaagaccttatgagtgcagagaatgtgggaaattcttctccagtctccttgaa
cacaggagagttcacactggagaaaggccttatgaatgcagggaatgtggaaaaacattt
actcgaaggtctgcgcattttaaacatcagagacttcatactcgaggaaagccttacgag
tgcagcgaatgtgggaaatcctttgctgaaaccttcagtcttactgaacacaggagagta
cacactggagaaaggccttatgagtgcagtgaatgtggaaaatcatttcatcgaagctct
tctctccttcgacatcagagagttcacacagaaagaagtccttacaagtga

KEGG   Homo sapiens (human): 147687
Entry
147687            CDS       T01001                                 
Symbol
ZNF417
Name
(RefSeq) zinc finger protein 417
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    147687 (ZNF417)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    147687 (ZNF417)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    147687 (ZNF417)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 KRAB zf-C2H2_6 zf-C2H2_jaz Zn-ribbon_8 zinc_ribbon_15 zf_UBZ
Other DBs
NCBI-GeneID: 147687
NCBI-ProteinID: NP_689688
HGNC: 20646
Ensembl: ENSG00000173480
Pharos: Q8TAU3(Tdark)
UniProt: Q8TAU3
LinkDB
Position
19:complement(57905774..57916592)
AA seq 575 aa
MAAAAPRRPTQQGTVTFEDVAVNFSQEEWCLLSEAQRCLYRDVMLENLALISSLGCWCGS
KDEEAPCKQRISVQRESQSRTPRAGVSPKKAHPCEMCGLILEDVFHFADHQETHHKQKLN
RSGACGKNLDDTAYLHQHQKQHIGEKFYRKSVREASFVKKRKLRVSQEPFVFREFGKDVL
PSSGLCQEAAAVEKTDSETMHGPPFQEGKTNYSCGKRTKAFSTKHSVIPHQKLFTRDGCY
VCSDCGKSFSRYVSFSNHQRDHTAKGPYDCGECGKSYSRKSSLIQHQRVHTGKTAYPCEE
CGKSFSQKGSLISHQRVHTGERPYECREYGKSFGQKGNLIQHQQGHTGERAYHCGECGKS
FRQKFCFINHQRVHTGERPYKCGECGKSFGQKGNLVQHQRGHTGERPYECKECGKSFRYR
SHLTEHQRLHTGERPYNCRECGKLFNRKYHLLVHERVHTGERPYACEVCGKLFGNKNCVT
IHQRIHTGERPYECNECGKSFLSSSALHVHKRVHSGQKPYKCSECGKSFAECSSLIKHRR
IHTGERPYECTKCGKTFQRSSTLLHHQSSHRRKAL
NT seq 1728 nt   +upstreamnt  +downstreamnt
atggcagcggctgcgccgaggcgcccgactcagcagggcactgtgacctttgaagatgtg
gctgtgaacttttcccaggaggagtggtgtcttcttagtgaggctcagaggtgcttgtac
cgtgatgtgatgctagagaacctggctctcatatcctcgctgggttgttggtgtggatca
aaagatgaggaggcaccttgtaagcagagaatttctgtacaaagagagtctcagagcagg
actcctagggcaggtgtttctcctaagaaggctcacccctgtgaaatgtgtggcctcatc
ttggaggatgtttttcactttgctgaccaccaggaaactcatcacaagcagaagctgaac
aggagtggagcatgtggaaaaaacttggatgacactgcataccttcatcagcaccagaag
cagcatattggagagaaattctacagaaagagtgtcagagaagcatcgtttgtaaagaaa
cgtaagctcagggtgtcacaggagccatttgtcttccgcgagtttgggaaggacgttctg
cccagttcaggattgtgccaagaagcagctgctgtagagaagacagacagtgaaactatg
catggcccaccctttcaggagggaaaaactaattacagttgtggaaaacgcacaaaagcc
ttcagcaccaaacactcagttattccacaccagaaacttttcactagagatggatgttat
gtgtgcagtgattgtggaaaatcctttagcagatatgtcagcttcagtaatcatcagcga
gatcacactgcaaaaggaccttatgattgtggagagtgtgggaaatcttatagtcgaaag
agcagccttattcaacatcagcgagtccacactggaaagacagcttatccctgtgaggag
tgcgggaaatcttttagtcagaagggcagccttattagccatcagcgtgttcacactgga
gaaaggccttatgagtgtagagaatatgggaaatcttttggtcaaaagggtaacctcatt
caacatcagcaaggtcacactggagagagagcttatcactgtggggaatgtgggaaatct
tttcgtcagaagttctgctttattaaccatcagcgtgttcacactggagaaaggccttac
aagtgtggagaatgtggaaaatcttttggtcaaaagggcaacctcgttcaacatcagcga
ggtcatactggagaaaggccctatgagtgcaaggaatgtgggaaatcatttaggtacaga
tcccacctcactgaacaccagagacttcacactggggaaagaccttacaattgtagggaa
tgtgggaaattatttaacaggaagtatcatcttctcgttcatgagagagttcacactgga
gaaaggccatatgcgtgtgaggtatgtgggaaattatttggtaataagaactgcgtgact
atacatcagaggattcacactggagaaaggccgtatgaatgcaatgaatgtgggaaatca
tttctttccagctctgcgcttcatgttcataaaagagttcattctggacaaaagccttat
aagtgcagtgaatgtggaaaatcctttgctgaatgttccagtctcattaaacacaggaga
attcacactggagaaaggccttatgaatgtaccaaatgtggaaaaacatttcagcgaagc
tctaccctccttcatcatcagagttcacacaggagaaaggccttatga

KEGG   Homo sapiens (human): 147694
Entry
147694            CDS       T01001                                 
Symbol
ZNF548
Name
(RefSeq) zinc finger protein 548
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    147694 (ZNF548)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    147694 (ZNF548)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    147694 (ZNF548)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 KRAB zf-C2H2_6 Zn-ribbon_8 C1_1 zinc_ribbon_15 zf_UBZ XPA_N
Other DBs
NCBI-GeneID: 147694
NCBI-ProteinID: NP_690873
HGNC: 26561
Ensembl: ENSG00000188785
Pharos: Q8NEK5(Tdark)
UniProt: Q8NEK5
LinkDB
Position
19:57389854..57402992
AA seq 533 aa
MNLTEGRVVFEDVAIYFSQEEWGHLDEAQRLLYRDVMLENLALLSSLGSWHGAEDEEAPS
QQGFSVGVSEVTASKPCLSSQKVHPSETCGPPLKDILCLVEHNGIHPEQHIYICEAELFQ
HPKQQIGENLSRGDDWIPSFGKNHRVHMAEEIFTCMEGWKDLPATSCLLQHQGPQSEWKP
YRDTEDREAFQTGQNDYKCSECGKTFTCSYSFVEHQKIHTGERSYECNKCGKFFKYSANF
MKHQTVHTSERTYECRECGKSFMYNYRLMRHKRVHTGERPYECNTCGKFFRYSSTFVRHQ
RVHTGERPYECRECGKFFMDSSTLIKHQRVHTGERPYKCNDCGKFFRYISTLIRHQRIHT
GERPYECSVCGELFRYNSSLVKHWRNHTGERPYKCSECGKSFRYHCRLIRHQRVHTGERP
YECSECGKFFRYNSNLIKHWRNHTGERPYECRECGKAFSHKHILVEHQKIHSGERPYECS
ECQKAFIRKSHLVHHQKIHSEERLVCSMNVGNSLAKTPTSLNIRDFTMEKVYH
NT seq 1602 nt   +upstreamnt  +downstreamnt
atgaacctgactgagggccgtgtggtctttgaggacgtggccatatatttctcccaggag
gagtgggggcaccttgatgaggctcagagattgctgtaccgtgatgtgatgctggagaat
ttggcccttttgtcctcactaggttcttggcatggagctgaggatgaggaggcaccttca
cagcaaggtttttctgtaggagtgtcagaggttacagcttcaaagccctgtctgtccagc
cagaaggtccaccctagtgagacatgtggcccacccttgaaagacattctgtgcctggtt
gagcacaatggaattcatcctgagcaacacatatatatttgtgaggcagagctttttcag
cacccaaagcagcaaattggagaaaatctttccagaggggatgattggataccttcattt
gggaagaaccacagagttcacatggcagaggagatcttcacatgcatggagggctggaag
gacttaccagccacctcatgccttctccagcaccagggccctcaaagcgagtggaagcca
tacagggacacagaggacagagaagcctttcagactggacaaaatgattacaaatgtagt
gaatgtgggaaaaccttcacctgcagctattcatttgttgagcaccagaaaatccacaca
ggagaaaggtcttatgaatgtaacaaatgtgggaaattctttaagtacagtgccaatttc
atgaaacatcagacagttcacactagtgaaaggacttatgagtgcagagaatgtggaaaa
tcctttatgtacaactaccgactcatgagacataagcgagttcacactggagaaaggcct
tatgagtgcaacacatgtgggaaattctttcggtacagctccacatttgttagacatcag
agagttcacaccggagaaaggccgtatgagtgcagggaatgtgggaaattctttatggac
agctccacactcattaaacatcagagagttcacaccggagaaagaccttataagtgcaat
gattgtgggaaattttttaggtatatctccacactcattagacatcagagaattcacact
ggagaaaggccttatgagtgcagtgtatgtggggaattgtttaggtacaactccagcctt
gttaaacattggagaaatcacactggagaaaggccttataaatgcagtgaatgtgggaaa
tcatttaggtaccactgcaggctcattagacaccagagagtccacacgggagaaaggcct
tatgagtgcagcgaatgcgggaaattctttcgttacaactccaacctcattaaacattgg
agaaatcacactggagaaaggccttacgagtgcagagagtgtgggaaagcctttagccac
aagcatatacttgttgagcaccagaaaatccacagtggagaaagaccttatgagtgcagc
gaatgccagaaggcctttattagaaagtctcacctggttcatcaccagaaaatccacagt
gaagagaggcttgtgtgctccatgaatgtggggaattctttagctaaaactccaacctca
ttaaacatcagagatttcacaatggagaaagtttaccattga

KEGG   Homo sapiens (human): 147741
Entry
147741            CDS       T01001                                 
Symbol
ZNF560
Name
(RefSeq) zinc finger protein 560
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    147741 (ZNF560)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    147741 (ZNF560)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    147741 (ZNF560)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 KRAB zf-C2H2_4 zf-C2H2_6 zf-C2H2_11 Zn-ribbon_8 zf-C2H2_jaz zinc_ribbon_15 zf-C2HE
Other DBs
NCBI-GeneID: 147741
NCBI-ProteinID: NP_689689
HGNC: 26484
Ensembl: ENSG00000198028
Pharos: Q96MR9(Tdark)
UniProt: Q96MR9
LinkDB
Position
19:complement(9445876..9506692)
AA seq 790 aa
MAYCLTNCYQYSVTFEDTAVDFTQEEWILLDPVQRNLYRDVMLENYENVAKVGFQLFKPS
VISWLEEEELRTLQQGVLQDWAIKHQTSVSALQQEFWKIQTSNGIQMDLVTFDSVAVEFT
QEEWTLLDPAQRNLYSDVMLENYKNLSSVGYQLFKPSLISWLEEEEELSTLPRVLQEWKM
CLKTKGPALWQDNFCLKTLNGIQLARNQNGEELYDCKQCEDVFCKHPCLKTNMSTQNRGN
TSECIQYAKDLLSLYNKTSTIRKVSVFSKHGKSFRLILNVQVQRKCTQDKSFEGTDYGKA
FIYQSYLEAHRKTQSGEKLNEWKQCGEAFTHSTSHAVNVETHIIKNPYECKECGKDFRYP
THLNNHMQTHIGIKPYKCKHCGKTFTVPSGFLEHVRTHTGEKPYGCKECGKAFGTSAGLI
EHIRCHAREKTFKCDHCGKAFISYPSLFGHLRVHNGEKPYEHKEYGKAFGTSSGVIEDRR
SNTGQKRFDCDQCGKVFVSFSSLFAHLRTHTGEKPFKCYKCGKPFTSSACLRIHMRTHTE
ERLYQCKKCGKAFTKCSYLTKHLRTHAGEKPYECMKCGKAFTERSYLTKHLRRHSGEKPY
ECKKCGKAFTERSDLTKHLRRHTGDKPYEYKDCGKAFVVSSSLVDHLRTHTGYKPYKCNA
CEKAYSRSCVLTQHLKTHAAEKTSECNACGNSFRNSMCFHDRLKTLTKIKPYKCKDCGKA
FTCHSDLTNHVRIHTGEKPYKCKECGKAFRTSSGRIQHLRTHMGEKPFECDQCGKAFASF
SARIAHLKTH
NT seq 2373 nt   +upstreamnt  +downstreamnt
atggcttactgcctgacaaattgttatcagtactccgtgacctttgaggatacagctgtg
gacttcacccaggaggagtggattttactggacccagttcagagaaacttatacagagat
gtgatgctggagaattatgagaacgtggccaaagtaggatttcagctctttaaacccagt
gtcatctcttggttggaagaagaagagttgagaaccttgcagcaaggagttctccaagac
tgggcaataaaacatcaaaccagtgtttcagcactgcagcaggagttttggaaaatacaa
acttctaatgggatacaaatggacctggtaacctttgacagtgtggctgtggagttcacc
caggaagagtggactttactggacccagctcagagaaacctgtacagtgatgtgatgctg
gagaactacaagaacctgtcctcagtaggttaccagctcttcaaacccagtctgatctct
tggctggaggaagaggaagagttgagcacactgccaagagttctccaagaatggaaaatg
tgcctgaaaaccaaagggccagccctttggcaagataatttttgtttaaaaacattaaat
gggatacagttggcaagaaaccaaaatggagaggaactctatgactgtaagcaatgtgaa
gatgtcttctgtaaacatccatgccttaagaccaacatgagtactcaaaatagaggcaac
acgtctgaatgtattcagtatgcaaaagacctcctttctctatacaataaaacctctacc
ataaggaaagtttctgtgttcagtaagcatggaaaatctttccgcctgattttaaatgtt
caggtccagagaaagtgtacacaagataaatcctttgaaggcactgactatgggaaagcc
ttcatttatcagtcataccttgaagcacacaggaaaactcagagtggagaaaaactcaat
gaatggaagcaatgtggggaagcatttactcactccacaagccatgctgtaaatgttgaa
acacacattattaaaaacccctatgaatgtaaggaatgtggaaaagattttagataccct
acccaccttaataatcacatgcaaacccacattgggataaaaccttataaatgtaagcac
tgtggcaaaaccttcactgtgccgtcaggctttcttgaacatgtacgaactcacactgga
gagaagccctatgggtgtaaggaatgtggtaaagcctttggtacatctgcaggccttatt
gaacatataagatgtcacgccagagagaaaacctttaaatgtgaccactgtgggaaagcc
tttatttcttacccatctctttttggacatttgagagttcataatggagagaagccatat
gagcataaggaatatgggaaggcctttggtacatcctcaggtgttattgaagatagaaga
agtaacacaggacagaaacgctttgattgtgaccagtgtgggaaagtctttgtttctttc
tcatctctttttgctcatttgagaactcacactggtgagaagccctttaagtgttacaaa
tgtgggaaaccatttacctcttctgcctgtcttcgtattcacatgcgaactcacacagaa
gagagactctatcaatgtaagaaatgtggtaaagctttcactaagtgctcatatcttacc
aaacatttacgaacacacgctggagagaaaccctatgaatgtatgaaatgtgggaaagcc
ttcactgagcgctcataccttactaaacatttacgaagacacagtggagagaagccatat
gaatgtaagaaatgtggaaaagccttcacagaacgctcagatcttactaaacatttacga
agacacactggagataagccctatgaatataaggactgtgggaaagcctttgttgtctcc
tccagtctagttgatcatttaagaactcacactggatataaaccctataaatgtaatgca
tgtgaaaaagcttacagtaggtcttgtgtactaactcaacacttaaaaactcatgcagca
gagaagacctctgaatgtaacgcatgtggaaattcctttcgaaattccatgtgctttcat
gatcgcttaaaaactctcaccaaaataaaaccctataaatgtaaggactgtgggaaagcc
ttcacttgtcattcagatcttactaatcatgtgcgaattcacactggagagaagccctat
aaatgtaaggaatgtgggaaggccttccgtacatcctcaggacgtattcaacatttaaga
actcatatgggagagaaaccctttgaatgtgaccagtgtgggaaagcctttgcttctttc
tcagctcgtattgcacatttgaaaacacactag

KEGG   Homo sapiens (human): 147837
Entry
147837            CDS       T01001                                 
Symbol
ZNF563
Name
(RefSeq) zinc finger protein 563
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    147837 (ZNF563)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    147837 (ZNF563)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    147837 (ZNF563)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 KRAB zf-C2H2_jaz zf-C2H2_6 Zn_ribbon_SprT Zn-ribbon_8 C1_1 zf-C2H2_11 zf_UBZ zinc_ribbon_15 Yippee-Mis18 zf-met DUF5830 HMBD
Other DBs
NCBI-GeneID: 147837
NCBI-ProteinID: NP_660319
HGNC: 30498
Ensembl: ENSG00000188868
Pharos: Q8TA94(Tdark)
UniProt: Q8TA94
LinkDB
Position
19:complement(12317477..12347390)
AA seq 476 aa
MDAVAFEDVAVNFTQEEWALLGPSQKNLYRYVMQETIRNLDCIRMIWEEQNTEDQYKNPR
RNLRCHMVERFSESKDSSQCGETFSLIRDSIVNNSICPGEDPCQSAECEEVIMGHLSLNS
HIRVDSGHKPHEYQEYGEKPHTHKQRGKAFSYHHSFQSRGRPHTGKKRYECKECGKTFSS
RRNLRRHMVVQGGNRPYKCKLCGKAFFWPSLLRMHERTHTGEKPYECKQCSKAFPFYSSY
RRHERMHTGEKPYECKQCSKALPDSSSYIRHERTHTGEKPYTCKQCGKAFSVSSSLRRHE
TTHSAEKPYECKQCGKTFHHLGSFQIHMKRHTGDRPHKCKICGKGFDRPSLVRYHERIHT
GEKPYECKQCGKTLSHSSSFRRHMIMHTGGGPHKCKICGKAFVYPSVCQRHEKSHSGEKP
YECKQCGKALSHSSSFRRHMVMHTGDGPNKCKVCGKAFVYPSVCQRHEKTHWRETI
NT seq 1431 nt   +upstreamnt  +downstreamnt
atggacgcagtggcctttgaggatgtggctgtgaacttcacccaggaggaatgggctttg
ctgggtccatcacagaagaatttatacagatatgtgatgcaagaaaccatcaggaacctg
gactgtataagaatgatatgggaagaacagaatactgaagatcagtacaaaaatcctagg
agaaatctaagatgtcatatggtagagagattcagtgaaagtaaagacagtagtcagtgt
ggagaaacatttagcctcattcgagatagtattgtgaacaacagcatttgtcctggagaa
gatccatgtcaaagcgctgagtgtgaagaagtcataatgggtcatttatcccttaatagc
cacatcagagttgattctggacacaaaccacatgagtatcaggaatatggagagaagcca
catacacataaacaacgtgggaaagccttcagttaccatcactcctttcagtcgcgtgga
aggcctcacactggaaagaaacgctatgagtgtaaggaatgtggaaaaaccttcagttct
cgtagaaaccttcgaagacacatggtagtgcaaggtggaaatagaccttataaatgtaag
ttgtgtgggaaagcttttttttggcccagtttattacgtatgcatgaaagaactcacact
ggagagaaaccgtatgaatgtaagcagtgttctaaagcctttcctttttacagttcctat
cgaagacatgagagaatgcacactggggagaaaccgtatgaatgtaagcagtgttctaaa
gccttgcctgattccagttcctatataagacatgaaagaactcacactggagagaaacca
tatacatgtaaacagtgtgggaaagccttcagtgtttccagttcccttcgaagacatgaa
accactcacagtgcagagaaaccctatgagtgtaagcaatgcgggaaaacatttcatcat
cttggaagctttcagatacacatgaaaaggcacactggagatcgacctcataaatgtaag
atatgtgggaaaggctttgatcgtcccagtttagttcgatatcatgaacgaattcacact
ggagagaaaccctatgaatgcaagcagtgtgggaaaacgttatctcatagctcaagcttt
cgaagacacatgataatgcacactggaggtggacctcataaatgcaagatatgtgggaaa
gcttttgtttatcctagtgtatgtcaaagacacgaaaagtctcacagtggagagaaaccc
tatgaatgcaagcagtgtgggaaagcgttatctcatagctcaagctttcgaagacatatg
gtaatgcatacgggagatgggccgaataaatgcaaggtatgtgggaaagcctttgtttat
cccagtgtatgtcaaagacatgaaaagactcactggagagaaacaatatga

KEGG   Homo sapiens (human): 147923
Entry
147923            CDS       T01001                                 
Symbol
ZNF420, APAK
Name
(RefSeq) zinc finger protein 420
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    147923 (ZNF420)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    147923 (ZNF420)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    147923 (ZNF420)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_jaz zf-C2H2_6 KRAB Zn-ribbon_8 XPA_N zf_UBZ zinc_ribbon_15 C1_4 zf-C2H2_11 Zn_ribbon_SprT HVO_2753_ZBP
Other DBs
NCBI-GeneID: 147923
NCBI-ProteinID: NP_653290
OMIM: 617216
HGNC: 20649
Ensembl: ENSG00000197050
Pharos: Q8TAQ5(Tbio)
UniProt: Q8TAQ5
LinkDB
Position
19:37007902..37130368
AA seq 688 aa
MARKLVMFRDVAIDFSQEEWECLDSAQRDLYRDVMLENYSNLVSLDLPSRCASKDLSPEK
NTYETELSQWEMSDRLENCDLEESNSRDYLEAKGKMEKQQENQKEYFRQGMIIYDKMSIF
NQHTYLSQHSRCHSTEKPYKCKECGKAFRRASHLTQHQSIHTGEKPYECKQCGKAFSRDS
QLSLHQRLHTGEKPYACKECGKAFTQSSQLILHHRIHTGEKPYKCEECGKAFIRSSQLTR
HQKVHTGEKPYECKECGKAFTQNSQLTLHQRLHTGEKLYECKECRKVFTQLSQLILHKRI
HTGEKPYECKECGKAFICGSQLSQHQKIHNGEKPYECKECGRAFIRGSLLMQHQRIHTGE
KPYKCEECGKAFIRGSQLTQHQRIHTNEKPYECKECGKMFSHGSQLTQHQRIHTGEKPYQ
CKECGKAFNRGSLLTRHQRIHTGEKPYECKECGKTFSRGSELTQHERIHTGEKPYECKEC
GKSFIRGSQLTQHQRIHTGEKPYECKECRMAFTQSSHLSQHQRLHTGEKPYVCNECGKAF
ARGLLLIQHQRIHTGEKPYQCKECGKAFIRGSQLTQHQRIHTGEKPYECKECGKAFSHGS
QLTLHQRIHTGEKPYECRECRKAFTQSSHLSRHQRIHTGEKPYQCKECGKAFTRGSQLTQ
HQRIHISEKSFEYKECGIDFSHGSQVYM
NT seq 2067 nt   +upstreamnt  +downstreamnt
atggctcggaaattagtgatgttcagggatgttgccattgacttctctcaggaagagtgg
gaatgcctggactctgctcagagagatttgtatagagatgtgatgttggagaactatagc
aacttggtatcactagacttgccttcaaggtgtgcaagtaaggacttatctccagaaaag
aacacttatgaaacagaattatcccaatgggaaatgagtgacagacttgaaaactgtgat
cttgaagagtccaattccagggattatttggaagccaaaggcaagatggagaagcaacaa
gaaaatcagaaggaatatttcaggcaagggatgatcatatatgacaaaatgtccattttc
aaccagcatacttacttatctcaacattcaagatgtcattctactgagaaaccctataaa
tgtaaggaatgtgggaaagccttcagacgagcctcacacctaacacaacatcaaagtatt
catactggtgaaaaaccctatgaatgtaagcaatgcgggaaggcctttagtcgtgattca
caactcagtcttcatcagagacttcatactggtgagaaaccctatgcatgtaaggaatgt
gggaaggcctttactcaaagctcacaacttattttacatcatagaattcatactggtgaa
aaaccatataaatgtgaagaatgtgggaaagcctttattcgtagctcacaacttacccga
catcaaaaagttcatactggtgagaaaccttatgaatgtaaagaatgtgggaaggccttt
actcagaattcacaacttacactacaccagagacttcatactggtgaaaagctctatgaa
tgtaaagaatgtaggaaggtctttactcagctctcacaacttattctgcataagagaatt
cataccggtgagaaaccctatgaatgtaaggaatgtggaaaagcttttatttgtggctca
cagctttctcaacatcagaaaattcataatggggaaaaaccatatgaatgtaaggaatgt
ggaagggcctttattcggggctcactactgatgcaacatcagaggattcatactggtgaa
aaaccctataaatgtgaagaatgtgggaaggcctttatccgtggctcacaacttactcaa
caccagagaattcacaccaatgaaaagccctatgaatgtaaggaatgtggaaagatgttt
agtcatggctcacaacttactcaacatcagagaatacacactggtgagaaaccctatcaa
tgtaaggaatgtggaaaagcgtttaatcgtggctcactccttacacgacaccagaggatt
catactggtgagaaaccctatgaatgtaaagaatgtggaaaaacctttagtcgtggctca
gaacttactcaacatgagcgaattcacacaggtgagaaaccctatgaatgtaaggaatgt
gggaaatcttttattcgtggttcccagcttactcaacatcagagaatccatactggtgag
aaaccttatgaatgtaaagaatgtagaatggcctttactcagagttcacatctttcccaa
catcaaagacttcacactggtgagaaaccctatgtgtgtaatgaatgtggaaaggccttt
gcgcgtggcttactacttatacaacatcagagaattcatactggtgagaaaccatatcaa
tgtaaggaatgtgggaaagcctttattcgtggttcacagttgactcaacatcagcgaatt
cacactggagaaaaaccctatgaatgcaaggagtgtggcaaggcctttagtcatggctct
cagcttactctacatcagagaatccatactggtgagaagccctatgaatgcagagaatgt
agaaaggcctttactcagagttcacatctttctcggcatcagagaattcatactggtgag
aaaccatatcaatgtaaggaatgtgggaaggcctttactcgtggttcacagctaactcaa
catcagagaattcatatcagtgagaaatcttttgaatataaggaatgtgggattgacttt
agtcatggctcacaagtttacatgtga

KEGG   Homo sapiens (human): 147929
Entry
147929            CDS       T01001                                 
Symbol
ZNF565
Name
(RefSeq) zinc finger protein 565
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    147929 (ZNF565)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    147929 (ZNF565)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    147929 (ZNF565)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 KRAB zf-C2H2_jaz zf-C2H2_6 Zn-ribbon_8 zf-trcl zinc_ribbon_15 Zn_ribbon_SprT C1_4 Pneumo_NS1
Other DBs
NCBI-GeneID: 147929
NCBI-ProteinID: NP_001035939
OMIM: 614275
HGNC: 26726
Ensembl: ENSG00000196357
Pharos: Q8N9K5(Tdark)
UniProt: Q8N9K5
LinkDB
Position
19:complement(36182060..36245928)
AA seq 499 aa
MAQGLVTFRDVAIEFSLEEWKCLEPAQRDLYREVTLENFGHLASLGLSISKPDVVSLLEQ
GKEPWMIANDVTGPWCPDLESRCEKFLQKDIFEIGAFNWEIMESLKCSDLEGSDFRADWE
CEGQFERQVNEECYFKQVNVTYGHMPVFQHHTSHTVRQSRETGEKLMECHECGKAFSRGS
HLIQHQKIHTGEKPFGCKECGKAFSRASHLVQHQRIHTGEKPYDCKDCGKAFGRTSELIL
HQRLHTGVKPYECKECGKTFRQHSQLILHQRTHTGEKPYVCKDCGKAFIRGSQLTVHRRI
HTGARPYECKECGKAFRQHSQLTVHQRIHTGEKPYECKECGKGFIHSSEVTRHQRIHSGE
KPYECKECGKAFRQHAQLTRHQRVHTGDRPYECKDCGKAFSRSSYLIQHQRIHTGDKPYE
CKECGKAFIRVSQLTHHQRIHTCEKPYECRECGMAFIRSSQLTEHQRIHPGIKPYECREC
GQAFILGSQLIEHYRIHTG
NT seq 1500 nt   +upstreamnt  +downstreamnt
atggcccagggactggtgacattcagggacgtggccatagagttctctctggaagaatgg
aagtgcctggaacctgctcagagggacttgtacagggaggtgactctggagaactttggt
cacttggcctcactaggactctccatttctaagcctgatgtcgtctccttattggagcaa
gggaaagagccctggatgattgcaaatgatgtgacaggaccatggtgcccagacttggag
tccaggtgtgagaaatttctacaaaaagacatttttgaaatcggggcattcaactgggag
ataatggaaagccttaaatgcagtgacctggagggctccgattttagagctgactgggaa
tgcgaaggccagtttgagagacaagtcaatgaagagtgctattttaagcaagtgaacgtc
acctatggacatatgcccgtgttccagcatcacacgtctcacactgtacgtcagagcagg
gagactggtgagaaactgatggaatgtcatgaatgtgggaaagcatttagccgtggctca
caccttattcaacatcagaaaattcacactggtgaaaaaccctttggatgtaaggaatgt
gggaaggccttcagccgtgcctcacaccttgttcagcatcagagaattcacacgggtgag
aaaccttatgactgtaaggactgtgggaaggcctttggtcgtacatcagaacttattcta
catcagagacttcatactggtgtcaaaccttatgaatgtaaagaatgtgggaagaccttt
aggcagcattcacagctgattctgcatcaaagaactcacacaggcgagaaaccctacgta
tgtaaagactgtggcaaggctttcattcgtggctcccaactcactgtgcatcggagaatc
cacacaggggccagaccctatgagtgtaaagaatgcgggaaagcctttagacagcactca
cagctgactgtacaccagcgaatccacactggtgagaaaccctacgagtgtaaggaatgc
ggaaagggctttattcacagctcagaagttactcgacatcaaagaattcattctggggag
aaaccctatgagtgtaaggaatgtgggaaggccttcagacagcacgcacagctcacacga
catcagagagtccatactggcgacagaccctatgaatgtaaggactgcgggaaggcattt
agtcgtagctcatacctcattcaacatcaaagaattcatacaggtgacaaaccctacgaa
tgtaaggaatgtgggaaggcctttattcgtgtttcacaactgactcatcatcagcgaatt
cacacttgtgagaaaccctatgaatgcagggagtgtggaatggcctttattcgtagttca
caacttaccgaacatcagagaattcatcctggtatcaaaccttacgaatgtagagagtgt
gggcaggcatttattcttggctcacaactcattgaacactacagaattcatactggttag

KEGG   Homo sapiens (human): 147948
Entry
147948            CDS       T01001                                 
Symbol
ZNF582
Name
(RefSeq) zinc finger protein 582
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    147948 (ZNF582)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    147948 (ZNF582)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    147948 (ZNF582)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 KRAB zf-C2H2_6 zf-C2H2_jaz Zn-ribbon_8 zf-met zinc_ribbon_15 Zn_Tnp_IS1595 Zn_ribbon_SprT
Other DBs
NCBI-GeneID: 147948
NCBI-ProteinID: NP_001307300
OMIM: 615600
HGNC: 26421
Ensembl: ENSG00000018869
Pharos: Q96NG8(Tdark)
UniProt: Q96NG8 A0A024R4P7
LinkDB
Position
19:complement(56382751..56393534)
AA seq 517 aa
MSLGSELFRDVAIVFSQEEWQWLAPAQRDLYRDVMLETYSNLVSLGLAVSKPDVISFLEQ
GKEPWMVERVVSGGLCPVLESRYDTKELFPKQHVYEVESPQWEIMESLTSYGLECSSFQD
DWECRNQFDRQQGNPDRHFHQMIIRHEEMPTFDQHASLTFYQKIHTREKPFGYNKCRKDF
WQKELLINHQGIYTNEKPYKCKECGKAFKYGSRLIQHENIHSGKKPYECKECGKAFNSGS
NFIQHQRVHTGEKPYECKDCEKAFSRSSQLIEHQRTHTGEKPYQCKECGKAFNRISHLKV
HYRIHTGEKPYACKECGKTFSHRSQLIQHQTVHTGRKLYECKECGKAFNQGSTLIRHQRI
HTGEKPYECKVCGKAFRVSSQLKQHQRIHTGEKPYQCKVCGRAFKRVSHLTVHYRIHTGE
KPYECKECGKAFSHCSQLIHHQVIHTEKKPYEYKECEKTLSHDSTTVQPQRMHNRETHVN
IINVEKPSISSYPLLIIREFMLASNHMNGSNGESPLA
NT seq 1554 nt   +upstreamnt  +downstreamnt
atgtcccttgggtcagaattgttcagggatgtggccatagtcttctcccaagaagaatgg
cagtggttggcacctgctcagagggatttgtacagagacgtgatgttggagacctacagc
aacctggtctcactgggtcttgccgtttccaaacctgatgtgatctccttcctagagcaa
ggcaaagagccctggatggtggagagagtggtgtctggaggcctgtgtccagtattggag
tccagatatgataccaaggaattatttccaaagcagcatgtttatgaagtcgaatcaccc
caatgggagataatggaaagccttacaagttatggtcttgagtgttcaagtttccaagat
gattgggaatgcagaaaccagtttgacagacaacagggaaatccagacagacatttccat
cagatgatcatcagacatgaagaaatgcccacttttgaccagcatgcatcccttactttt
tatcagaaaattcatactagagaaaaaccttttgggtataataaatgtagaaaagacttc
tggcaaaaggaactccttattaatcatcaaggaatttatactaatgagaaaccctataaa
tgtaaggaatgtgggaaggcctttaaatatggctcacgactaattcaacatgagaatatt
cattctggtaagaaaccatatgaatgtaaggaatgtggaaaggccttcaattctggttca
aattttatacaacatcagagagttcatactggtgagaaaccgtatgaatgtaaagattgt
gagaaggcctttagtcgaagctcacagttgattgaacatcagcgaactcacacaggcgag
aaaccctatcagtgtaaggaatgtggcaaggccttcaatcggatctcacatcttaaagta
cattatagaattcatactggtgaaaaaccctatgcatgcaaggaatgtgggaaaaccttt
agtcatcgttctcagttgattcaacatcagactgttcatactggcaggaaactctatgaa
tgtaaggaatgtgggaaggcttttaatcaaggctcaactcttatacgacatcagagaatt
cataccggtgagaaaccctatgagtgcaaagtatgtggaaaggcctttagagtgagctca
caactcaagcaacatcagagaattcacactggagagaaaccctaccaatgtaaggtatgt
ggtagggccttcaaacgggtctcacatcttactgtacattacagaattcatacaggtgaa
aagccatatgaatgtaaggaatgtgggaaggcttttagtcattgctcacaattgattcat
catcaggttattcacactgagaaaaagccctatgaatataaggaatgtgagaagaccttg
agtcatgattcaactaccgttcaacctcagagaatgcataatagagaaacacatgtgaat
ataataaatgtagaaaagccttccatcagcagttaccccttactaatcatcagagaattt
atgttggcaagcaaccatatgaatggaagtaatggggaaagcccattagcctag

KEGG   Homo sapiens (human): 147949
Entry
147949            CDS       T01001                                 
Symbol
ZNF583
Name
(RefSeq) zinc finger protein 583
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    147949 (ZNF583)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    147949 (ZNF583)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    147949 (ZNF583)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 KRAB zf-C2H2_jaz Zn-ribbon_8 zf-C2H2_6 zinc_ribbon_15 zf_C2H2_ZHX zf-LYAR C1_4 zf-C2H2_11
Other DBs
NCBI-GeneID: 147949
NCBI-ProteinID: NP_001153332
HGNC: 26427
Ensembl: ENSG00000198440
Pharos: Q96ND8(Tdark)
UniProt: Q96ND8
LinkDB
Position
19:56404014..56427364
AA seq 569 aa
MSKDLVTFGDVAVNFSQEEWEWLNPAQRNLYRKVMLENYRSLVSLGVSVSKPDVISLLEQ
GKEPWMVKKEGTRGPCPDWEYVFKNSEFSSKQETYEESSKVVTVGARHLSYSLDYPSLRE
DCQSEDWYKNQLGSQEVHLSQLIITHKEILPEVQNKEYNKSWQTFHQDTIFDIQQSFPTK
EKAHKHEPQKKSYRKKSVEMKHRKVYVEKKLLKCNDCEKVFNQSSSLTLHQRIHTGEKPY
ACVECGKTFSQSANLAQHKRIHTGEKPYECKECRKAFSQNAHLAQHQRVHTGEKPYQCKE
CKKAFSQIAHLTQHQRVHTGERPFECIECGKAFSNGSFLAQHQRIHTGEKPYVCNVCGKA
FSHRGYLIVHQRIHTGERPYECKECRKAFSQYAHLAQHQRVHTGEKPYECKVCRKAFSQI
AYLDQHQRVHTGEKPYECIECGKAFSNSSSLAQHQRSHTGEKPYMCKECRKTFSQNAGLA
QHQRIHTGEKPYECNVCGKAFSYSGSLTLHQRIHTGERPYECKDCRKSFRQRAHLAHHER
IHTMESFLTLSSPSPSTSNQLPRPVGFIS
NT seq 1710 nt   +upstreamnt  +downstreamnt
atgtccaaggatttggtgacatttggggatgtggctgtaaatttctctcaagaggaatgg
gaatggctgaaccctgctcagaggaatttgtacaggaaagtgatgttggagaactacagg
agcttggtatcattgggagtttctgtttctaagccagatgtgatctcattattggagcaa
ggaaaagagccctggatggtgaagaaggagggaacaagaggcccatgccctgattgggag
tatgtatttaaaaacagtgaattttcatcaaagcaagagacatatgaagaatcatccaaa
gttgtgacagtgggagcaagacatcttagttatagccttgactatcccagtttgagagaa
gactgtcaaagtgaggactggtataagaaccagctgggaagtcaagaggtacatcttagt
caattaatcatcactcataaagaaatccttccagaagttcaaaataaagaatataacaaa
tcttggcaaacattccaccaggatacaatctttgatatacaacagagttttcccaccaaa
gaaaaagcacataagcatgaaccacaaaagaaaagttaccgaaaaaaatctgttgaaatg
aaacataggaaagtctatgtagaaaagaaacttttgaaatgtaatgattgtgagaaagtc
ttcaaccagagctcatcccttactcttcatcagagaattcatactggagagaaaccctat
gcatgtgttgaatgtgggaaaacgttcagccagagtgcaaacttggcgcaacataagaga
atacatactggagagaaaccctatgaatgtaaagaatgtaggaaagccttcagccagaat
gcacacctggcccaacatcagagagttcatactggagagaaaccttatcagtgtaaagaa
tgtaaaaaagccttcagccagattgcacacctgactcagcatcagagagttcatactgga
gagagacctttcgaatgtattgaatgtggaaaggcctttagtaatggttcatttcttgct
cagcatcagagaattcatacaggagagaaaccttatgtgtgtaatgtgtgtgggaaagcc
tttagccatcgtggatacctaattgtacatcagagaattcatactggagagagaccctac
gaatgtaaggaatgtaggaaagccttcagccagtatgcacaccttgctcaacatcagaga
gttcatactggagaaaaaccttatgaatgtaaagtatgtaggaaagccttcagccaaatt
gcataccttgatcaacatcagagggttcatactggagagaaaccctatgaatgtattgaa
tgtgggaaggcctttagcaatagttcatcacttgcacaacatcagagaagtcatactgga
gaaaaaccctatatgtgtaaggaatgtaggaaaacatttagccagaatgcaggccttgct
caacatcagagaattcatactggagagaaaccttatgaatgtaatgtttgtgggaaagca
tttagctatagtggatctcttactctacatcagagaattcatactggagaaagaccctat
gaatgtaaagattgcaggaaatctttcaggcagcgtgcacatcttgctcatcatgagaga
attcatactatggagtcattcttgactctttcctctccctcaccctccacatcaaatcag
ttgccaagacctgtaggtttcatctcctga

KEGG   Homo sapiens (human): 148103
Entry
148103            CDS       T01001                                 
Symbol
ZNF599
Name
(RefSeq) zinc finger protein 599
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    148103 (ZNF599)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    148103 (ZNF599)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    148103 (ZNF599)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 KRAB zf-C2H2_jaz Zn_ribbon_SprT zinc_ribbon_15 Zn-ribbon_8 zf-C2H2_6 zf-C2H2_11 DUF6434 zf-H2C2_5 zf-AN1 Raffinose_syn
Other DBs
NCBI-GeneID: 148103
NCBI-ProteinID: NP_001007249
HGNC: 26408
Ensembl: ENSG00000153896
Pharos: Q96NL3(Tdark)
UniProt: Q96NL3
LinkDB
Position
19:complement(34758073..34807601)
AA seq 588 aa
MAAPALALVSFEDVVVTFTGEEWGHLDLAQRTLYQEVMLETCRLLVSLGHPVPKPELIYL
LEHGQELWTVKRGLSQSTCAGEKAKPKITEPTASQLAFSEESSFQELLAQRSSRDSRLGQ
ARDEEKLIKIQEGNLRPGTNPHKEICPEKLSYKHDDLEPDDSLGLRVLQERVTPQDALHE
CDSQGPGKDPMTDARNNPYTCTECGKGFSKKWALVRHQQIHAGVKPYECNECGKACRYMA
DVIRHMRLHTGEKPYKCIECGKAFKRRFHLTEHQRIHTGDKPYECKECGKAFTHRSSFIQ
HNMTHTREKPFLCKECGKAFYYSSSFAQHMRIHTGKKLYECGECGKAFTHRSTFIQHNVT
HTGEKPFLCKECGKTFCLNSSFTQHMRIHTGEKPYECGECGKAFTHRSTFIRHKRTHTGE
KPFECKECGKAFCDSSSLIQHMRIHTGEKPYECSECGKAFTHHSVFIRHNRTHSGQKPLE
CKECAKAFYYSSSFTRHMRIHTGEKPYVCRECGKAFTQPANFVRHNRIHTGEKPFECKEC
EKAFCDNFALTQHMRTHTGEKPFECNECGKTFSHSSSFTHHRKIHTRV
NT seq 1767 nt   +upstreamnt  +downstreamnt
atggcggcgccggcgttggcattagtatcatttgaagacgtggttgtgaccttcactgga
gaggaatgggggcacctggacctggcccagaggaccctgtaccaggaggtgatgctggag
acctgcaggctcctggtctcactggggcatcctgttcccaaaccagagctgatctatcta
ctggaacatggacaggaactgtggacagtgaagagaggcctctcccaaagcacctgcgca
ggtgaaaaagcaaaacccaagattacagagcctactgcttctcagctggccttctctgag
gaatcctctttccaggaacttctggcacagagatcctcaagagattccaggttggggcaa
gctagagatgaggaaaagctaataaaaattcaggaagggaacttgaggccaggaacaaac
ccccacaaagagatatgccctgagaagttgagttataaacatgatgatttggagccagat
gatagtctgggcttaagggttttacaggaacgagtcactccacaagatgctctccatgag
tgtgactctcaaggaccaggaaaagaccccatgactgatgcaaggaataacccttacaca
tgcacggaatgtgggaaagggtttagcaagaagtgggcccttgttcggcatcaacagatt
catgctggagtgaagccctatgagtgcaatgagtgtgggaaagcctgtcgttatatggct
gatgtcattcgacatatgaggcttcatactggggaaaaaccatacaagtgtattgagtgt
gggaaagccttcaaacgcaggtttcacctcacggagcaccagcgtattcacaccggagat
aagccctatgagtgcaaagaatgtggcaaagcattcacccaccgctcttcttttatccag
cataatatgactcacactcgagaaaaaccctttttatgcaaagaatgtgggaaagctttt
tactacagctcctcatttgctcaacatatgaggattcatactggaaagaaactctatgag
tgcggtgaatgtggaaaggccttcacgcaccgctccacatttatccagcacaatgtgacc
cacacaggagaaaaaccatttttatgtaaagaatgtggaaaaaccttttgcctcaactca
tccttcactcagcacatgaggattcacactggagagaaaccctatgagtgcggtgaatgt
ggaaaggcctttactcatcgctccactttcatccgacataagaggacccataccggagag
aagccctttgagtgcaaagaatgtgggaaggccttttgtgacagctcttccttaattcaa
catatgaggattcacactggtgagaagccttatgagtgcagtgaatgtggaaaggctttt
acacaccactctgtttttattcgacataataggacccacagtggacaaaaacccttggag
tgcaaagaatgtgcaaaagccttttactatagctcttccttcactcgacacatgaggatt
cacactggagagaagccctatgtttgtagagaatgtggaaaggcttttacccaacctgca
aattttgttcggcataataggatccacactggagaaaaaccttttgaatgcaaagaatgt
gagaaagccttctgtgacaactttgctttaactcagcacatgagaactcacactggagag
aaaccctttgaatgcaatgaatgtggaaagaccttcagccacagttcatcgttcactcac
catcgaaagattcataccagagtttaa

KEGG   Homo sapiens (human): 148156
Entry
148156            CDS       T01001                                 
Symbol
ZNF558
Name
(RefSeq) zinc finger protein 558
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    148156 (ZNF558)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    148156 (ZNF558)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    148156 (ZNF558)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 KRAB zf-C2H2_6 zf-C2H2_jaz zf-C2H2_11 Zn-ribbon_8 zinc_ribbon_15 HypA zf-C2HE zf-met XPA_N C1_4 zf-C2HC_2 zf-LYAR Zn_Tnp_IS1595
Other DBs
NCBI-GeneID: 148156
NCBI-ProteinID: NP_653294
HGNC: 26422
Ensembl: ENSG00000167785
Pharos: Q96NG5(Tdark)
UniProt: Q96NG5
LinkDB
Position
19:complement(8806170..8838144)
AA seq 402 aa
MAAVILPSTAAPSSLFPASQQKGHTQGGELVNELLTSWLRGLVTFEDVAVEFTQEEWALL
DPAQRTLYRDVMLENCRNLASLGCRVNKPSLISQLEQDKKVVTEERGILPSTCPDLETLL
KAKWLTPKKNVFRKEQSKGVKTERSHRGVKLNECNQCFKVFSTKSNLTQHKRIHTGEKPY
DCSQCGKSFSSRSYLTIHKRIHNGEKPYECNHCGKAFSDPSSLRLHLRIHTGEKPYECNQ
CFHVFRTSCNLKSHKRIHTGENHHECNQCGKAFSTRSSLTGHNSIHTGEKPYECHDCGKT
FRKSSYLTQHVRTHTGEKPYECNECGKSFSSSFSLTVHKRIHTGEKPYECSDCGKAFNNL
SAVKKHLRTHTGEKPYECNHCGKSFTSNSYLSVHKRIHNRWI
NT seq 1209 nt   +upstreamnt  +downstreamnt
atggcggctgtcatcctgccctcgactgctgctccgtcttccctgttcccagcctctcag
caaaaaggacacacacagggcggagagctggttaatgagctcctgacaagctggctacgg
ggcttggtaaccttcgaggatgtggccgtggagttcacccaggaggagtgggcgttgctg
gaccctgcccaaaggacactgtacagggatgtgatgctggagaactgcaggaacctggcc
tcactagggtgtcgtgttaataaacccagtctgatatcccagttggaacaagacaagaag
gtggtgacagaggaaagaggaattctaccaagcacctgtccagatttggagactctactt
aaagccaaatggttaactcctaagaagaatgttttcagaaaagaacagtctaaaggtgta
aaaacggaaagaagtcatcgtggagtgaaactcaatgaatgtaatcagtgttttaaagtc
ttcagcacgaaatctaacctaactcagcacaagagaattcatactggagaaaaaccctat
gactgtagtcaatgtgggaagtccttcagtagcagatcttaccttactattcataagaga
atccataatggggagaaaccctatgaatgcaatcactgtgggaaagcatttagtgatccc
tcatcccttagactgcatttgagaattcacactggagaaaaaccctatgaatgtaaccag
tgttttcacgttttccgcaccagttgtaacctcaaaagccacaagaggattcacacgggg
gagaatcaccatgaatgtaatcagtgtggaaaagctttcagcacaaggtcctctctcact
gggcacaatagcattcatacaggggagaaaccttatgaatgtcacgattgtgggaaaacc
ttcaggaagagctcctatctgacacagcacgtaagaactcatactggagaaaaaccctat
gaatgtaacgagtgtgggaaatccttcagcagtagcttttctcttactgtgcacaagaga
atacataccggagagaaaccctacgagtgcagtgactgtggaaaagcctttaataatctc
tcagctgtgaagaaacacttaagaactcacactggagaaaaaccctatgaatgtaatcat
tgtgggaaatccttcacaagtaactcctatctttctgtgcacaagagaatacataataga
tggatatga

KEGG   Homo sapiens (human): 148198
Entry
148198            CDS       T01001                                 
Symbol
ZNF98, F7175, ZNF739
Name
(RefSeq) zinc finger protein 98
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    148198 (ZNF98)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    148198 (ZNF98)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    148198 (ZNF98)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_6 KRAB zf-C2H2_jaz XPA_N zf_UBZ Zn-ribbon_8 zf-C2H2_11 BolA C1_4 Zn_ribbon_SprT zinc_ribbon_15 Evr1_Alr
Other DBs
NCBI-GeneID: 148198
NCBI-ProteinID: NP_001092096
OMIM: 603980
HGNC: 13174
Ensembl: ENSG00000197360
Pharos: A6NK75(Tdark)
UniProt: A6NK75
LinkDB
Position
19:complement(22391019..22422346)
AA seq 572 aa
MPGPLGSLEMGVLTFRDVALEFSLEEWQCLDTAQQNLYRNVMLENYRNLVFVGIAASKPD
LITCLEQGKEPWNVKRHEMVTEPPVVYSYFAQDLWPKQGKKNYFQKVILRTYKKCGRENL
QLRKYCKSMDECKVHKECYNGLNQCLTTTQNKIFQYDKYVKVFHKFSNSNRHKIGHTGKK
SFKCKECEKSFCMLSHLAQHKRIHSGEKPYKCKECGKAYNEASNLSTHKRIHTGKKPYKC
EECGKAFNRLSHLTTHKIIHTGKKPYKCEECGKAFNQSANLTTHKRIHTGEKPYKCEECG
RAFSQSSTLTAHKIIHAGEKPYKCEECGKAFSQSSTLTTHKIIHTGEKFYKCEECGKAFS
RLSHLTTHKRIHSGEKPYKCEECGKAFKQSSTLTTHKRIHAGEKFYKCEVCSKAFSRFSH
LTTHKRIHTGEKPYKCEECGKAFNLSSQLTTHKIIHTGEKPYKCEECGKAFNQSSTLSKH
KVIHTGEKPYKCEECGKAFNQSSHLTTHKMIHTGEKPYKCEECGKAFNNSSILNRHKMIH
TGEKLYKPESCNNACDNIAKISKYKRNCAGEK
NT seq 1719 nt   +upstreamnt  +downstreamnt
atgccaggaccccttggaagcctagaaatgggagtgttgacatttagggatgtggcctta
gaattctctctggaggagtggcaatgcctggacaccgcacagcagaatttatataggaat
gtgatgttagagaactacagaaacctggtctttgtgggtattgctgcctctaagccagac
ctgatcacctgtctggagcaaggaaaagaaccttggaatgtgaagagacatgagatggta
actgaacccccagttgtatattcttattttgcccaagacctttggccaaagcagggcaaa
aaaaattatttccaaaaagtgatactgagaacatataaaaaatgtggacgtgaaaattta
cagttaagaaaatactgtaaaagcatggatgagtgtaaggtgcacaaagaatgttacaat
ggacttaaccagtgtttgacaactacccagaacaaaatatttcaatatgacaaatatgtg
aaagtctttcataaattttcaaattcaaacagacataagataggacatactggaaagaaa
tctttcaagtgtaaagaatgtgaaaagtcattttgcatgctttcacacttagctcaacat
aaaagaattcatagtggagagaaaccctacaaatgtaaagaatgtgggaaagcctataat
gaggcctcaaacctttctacacataaaagaattcatactggaaagaaaccctacaaatgc
gaagagtgtggaaaagcctttaaccggctctcacaccttactacacataagataattcat
actggaaagaaaccctacaaatgtgaggagtgtggcaaagcttttaaccaatctgcaaac
cttactacacataagagaattcatactggagagaaaccctacaaatgtgaagaatgtggc
agagcttttagccagtcctcaacccttactgcacataagataattcatgctggagagaaa
ccttacaaatgtgaagaatgtggcaaagcttttagccagtcctcaacccttactacacat
aagataattcatactggagagaaattctacaaatgtgaagaatgtggtaaggcctttagc
cggttatcccaccttactacacataagagaattcattctggagagaaaccctacaagtgt
gaagaatgtggcaaagcttttaaacaatcctcaacccttactacacataagagaattcat
gctggagagaaattctacaaatgtgaagtatgtagcaaagcctttagccggttctcacac
cttactacacataagagaattcatactggagagaagccctacaaatgtgaagaatgtggc
aaagcttttaacctatcatcacaacttactacacataagataattcatactggagagaaa
ccctacaaatgtgaagaatgtggcaaagcttttaaccagtcctcaactctttctaaacat
aaggtaattcatactggagagaagccctacaaatgtgaagaatgtggcaaagcttttaac
cagtcctcacaccttactacacataagatgattcatactggagagaaaccctacaagtgt
gaagaatgcggcaaagcctttaacaactcctctattcttaacagacataagatgattcat
actggagagaaactctacaaacctgaaagttgtaacaatgcttgtgacaacattgcaaag
atttccaaatataaaagaaattgtgctggtgagaaataa

KEGG   Homo sapiens (human): 148206
Entry
148206            CDS       T01001                                 
Symbol
ZNF714
Name
(RefSeq) zinc finger protein 714
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    148206 (ZNF714)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    148206 (ZNF714)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    148206 (ZNF714)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_6 zf-C2H2_jaz XPA_N zf_UBZ Zn-ribbon_8 zf-C2H2_11 Zn_ribbon_SprT zinc_ribbon_15 C1_4 BolA KRAB
Other DBs
NCBI-GeneID: 148206
NCBI-ProteinID: NP_872321
HGNC: 27124
Ensembl: ENSG00000160352
Pharos: Q96N38(Tdark)
UniProt: Q96N38 A0A087WU35
LinkDB
Position
19:21082203..21125094
AA seq 555 aa
MNVMLENYKNLVFLAGIAVSKQDPITSLEQEKEPWNMKICEMVDESPAMCSSFTRDLWPE
QDIKDSFQQVILRRHGKCEHENLQLRKGSANVVECKVYKKGYNELNQCLTTTQSKIFPCD
KYIKVFHKIFNSNRHKTRHTGEKPFKCKKCDESFCMLLHLHQHKRIHIRENSYQCEECDK
VFKRFSTLTRHKRVHTGEKPFKCEECGKAFKHSSTLTTHKMIHTGEKPYRCEECGKAFYH
SSHLTTHKVIHTGEKPFKCEECGKAFNHPSALTTHKFIHVKEKPYKCEECDKAFNRFSYL
TKHKIIHSGEKSYKCEQCGKGFNWSSTLTKHKRIHTGEKPYKCEECGKAFNVSSHLTTHK
MIHTGEKPYKCEECGKAFNHSSKLTIHKIIHTGEKPYKCEECGKAFNQSSNLTKHKIIHT
GEKLYKCEECGKAFNRSSNLTTHKRIHTGEKPYKCEECGKAFNRSSNLTKHNIIHTGEKS
YKCEECGKAFNQSSTLTKHRKIQQGMVAHACNPNTLRGLGEQIARSGVQDQPGQHGKTPS
LLKIQKFAGCGGRRL
NT seq 1668 nt   +upstreamnt  +downstreamnt
atgaatgtgatgttagagaactacaaaaacctggtcttcttggcaggtattgctgtctct
aagcaagacccgatcaccagtctagagcaagaaaaagagccctggaatatgaagatatgt
gagatggtggatgaatccccagctatgtgttcttcttttaccagagacctttggccagag
caagacataaaagattcttttcaacaagtgatactgagaagacatggcaaatgtgaacat
gagaatttacagttaagaaaaggctccgcaaatgtggttgagtgtaaggtgtacaaaaaa
ggttataatgaactaaaccagtgtttgacaactacccagagcaaaatatttccatgtgat
aaatatataaaagtctttcataaaattttcaattcaaatagacacaagacaagacatact
ggagagaaacctttcaaatgtaaaaaatgtgatgaatcattttgcatgcttttacaccta
catcaacataaaagaattcatattagagagaattcttaccaatgtgaagaatgtgacaaa
gtgtttaagcggttctcaacccttactagacacaagagagttcatactggagagaaaccc
ttcaaatgtgaagaatgtggcaaagcttttaagcactcctcaacccttactacacataag
atgattcatactggagagaaaccctacagatgtgaagaatgtggcaaagccttctaccat
tcttcacaccttactacacataaggtaattcatactggagagaagcccttcaaatgtgaa
gaatgtggtaaagcttttaaccacccttcagcccttactacacataagttcattcatgtt
aaagaaaaaccctacaaatgtgaagaatgtgacaaagcttttaaccgattctcatacctt
actaaacataagataattcattctggagagaaatcttacaaatgtgaacaatgtggcaaa
ggctttaactggtcttcaacccttacaaaacataaaagaattcatactggagagaaaccc
tacaaatgtgaagaatgtggcaaagcctttaatgtgtcttcacaccttactacacataag
atgattcatactggagagaaaccctacaaatgtgaagaatgtggcaaagcctttaaccac
tcctcaaaacttactatacataagataattcatactggagagaaaccttacaaatgtgaa
gaatgtggcaaagcttttaaccaatcctcaaaccttaccaaacataagataattcatact
ggagagaaactctacaaatgtgaagaatgtggcaaagcttttaaccgatcctcaaacctt
actacacataagagaattcacactggagagaaaccctacaaatgtgaagaatgtggcaaa
gctttcaaccgatcctcaaaccttactaaacataacataattcatactggagagaaatct
tacaaatgtgaagaatgtggtaaagcctttaaccaatcctcaactcttactaaacatagg
aaaattcagcagggcatggtggctcatgcctgtaatcccaacactttgagaggactaggt
gagcagatcgcgaggtcaggagttcaagaccagcctggccaacatggtaaaaccccatct
ctactaaaaatacaaaaatttgctgggtgtggtggcaggcgcctgtaa

KEGG   Homo sapiens (human): 148254
Entry
148254            CDS       T01001                                 
Symbol
ZNF555
Name
(RefSeq) zinc finger protein 555
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    148254 (ZNF555)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    148254 (ZNF555)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    148254 (ZNF555)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_6 zf-C2H2_11 KRAB zf-C2H2_jaz Zn-ribbon_8 Zn_ribbon_SprT zf-trcl zinc_ribbon_15 zf-met
Other DBs
NCBI-GeneID: 148254
NCBI-ProteinID: NP_690004
HGNC: 28382
Ensembl: ENSG00000186300
Pharos: Q8NEP9(Tdark)
UniProt: Q8NEP9
LinkDB
Position
19:2841475..2860471
AA seq 628 aa
MDSVVFEDVAVDFTLEEWALLDSAQRDLYRDVMLETFQNLASVDDETQFKASGSVSQQDI
YGEKIPKESKIATFTRNVSWASVLGKIWDSLSIEDQTTNQGRNLSRNHGLERLCESNDQC
GEALSQIPHLNLYKKIPPGVKQYEYNTYGKVFMHRRTSLKSPITVHTGHKPYQCQECGQA
YSCRSHLRMHVRTHNGERPYVCKLCGKTFPRTSSLNRHVRIHTAEKTYECKQCGKAFIDF
SSLTSHLRSHTGEKPYKCKECGKAFSYSSTFRRHTITHTGEKPYKCKECAEAFSYSSTFR
RHMISHTGEKPHKCKECGEAFSYSSAFRRHMITHTGEKPYECKQCGKTFIYLQSFRRHER
IHTGEKPYECKQCGKTFIYPQSFRRHERTHGGEKPYECNQCGKAFSHPSSFRGHMRVHTG
EKPYECKQCGKTFNWPISLRKHMRTHTREKPYECKQCGKAFSLSACFREHVRMHPEDKSY
ECKLCGKAFYCHISLQKHMRRHTAEKLYKCKQCGKAFSWPELLQQHVRTHTVEKPYECKE
CGKVFKWPSSLPIHMRLHTGEKPYQCKHCGKAFNCSSSLRRHVRIHTTEKQYKCNVGHPP
ANEFMCSASEKSHQERDLIKVVNMVLPL
NT seq 1887 nt   +upstreamnt  +downstreamnt
atggactcagtggtctttgaggatgtggctgtggacttcaccctggaggagtgggctttg
ctggattctgctcagagggacctctacagagatgtgatgctggagacctttcagaacctg
gcctcagtagatgatgaaactcaatttaaggccagtgggtcagtttctcagcaggatatt
tatggagagaaaatacccaaggaatctaaaatagccacgttcaccagaaatgtttcctgg
gcctctgttttaggaaaaatttgggacagtcttagcatcgaagatcaaaccacaaaccag
gggagaaatctcagtagaaatcatgggttggagagactctgtgaaagtaatgatcaatgt
ggagaagccctcagccagattccacatcttaatctgtacaagaaaattccacctggagta
aaacagtatgaatacaacacgtacggaaaagtcttcatgcatcgccgcacatccctcaag
agtcccatcacagttcacactggacacaaaccatatcagtgccaggaatgtgggcaggcc
tacagttgtcgttcacacctaagaatgcatgtgagaacccacaatggagagagaccctat
gtgtgtaaattatgtgggaaaacctttcctcgtacttcctccctcaatcggcatgtaagg
attcacactgctgagaaaacctacgaatgtaagcaatgtgggaaagcctttattgacttc
tcaagtcttactagtcatctcagaagtcacaccggagagaagccatataagtgtaaggaa
tgtgggaaagctttcagttattcctcaacgtttcgaagacacacaataacacacactggc
gagaagccatataaatgtaaggaatgtgcggaagcctttagttattcctcaacttttcga
agacatatgatttcacacactggagagaagccacataaatgtaaagaatgtggggaggcc
ttcagttattcttcggcttttcgaagacacatgataacacacactggagagaaaccctac
gaatgcaaacaatgtgggaaaaccttcatttatctccagtcctttcgaagacatgaaagg
attcacactggagagaaaccctacgaatgcaaacagtgtgggaagaccttcatttatccc
cagtcctttcgaagacatgaaaggactcatggtggagagaaaccctatgaatgcaaccag
tgcgggaaagcattcagtcacccctcctcctttcgaggacacatgagggtgcacactgga
gagaaaccctatgagtgcaagcaatgtgggaaaactttcaattggcccatatctttacga
aaacatatgagaacacatactagagagaaaccctatgaatgtaagcagtgtgggaaagcc
ttcagcttgtctgcttgctttcgagaacatgtgagaatgcaccctgaagacaaatcctat
gaatgcaagctatgtgggaaagctttctattgccacatatccttacaaaaacatatgaga
agacataccgcagagaaactctataaatgcaagcagtgtgggaaagctttcagttggcct
gaacttttgcaacaacatgtgagaacgcacactgtagagaagccctatgaatgtaaggaa
tgtgggaaggtcttcaaatggccatcatctttaccaatacatatgagactgcacactgga
gagaaaccttatcaatgtaagcattgtgggaaagcattcaattgttcctcatccttaagg
cgacatgtgagaatacacactacagaaaaacagtataagtgtaatgtaggacatcctcct
gcaaatgaattcatgtgcagtgcttcagaaaagtcacaccaggagagagatctgatcaaa
gttgtaaatatggtgttgcctttatga

KEGG   Homo sapiens (human): 148266
Entry
148266            CDS       T01001                                 
Symbol
ZNF569, ZAP1, ZNF, Zfp74
Name
(RefSeq) zinc finger protein 569
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    148266 (ZNF569)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    148266 (ZNF569)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    148266 (ZNF569)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_6 KRAB Zn-ribbon_8 zf-C2H2_jaz zinc_ribbon_15 zf-C2H2_11 zf-C2HE zf-BED C1_4
Other DBs
NCBI-GeneID: 148266
NCBI-ProteinID: NP_689697
OMIM: 613904
HGNC: 24737
Ensembl: ENSG00000196437
Pharos: Q5MCW4(Tbio)
UniProt: Q5MCW4 A0A024R0G4
LinkDB
Position
19:complement(37411157..37469265)
AA seq 686 aa
MTESQGTVTFKDVAIDFTQEEWKRLDPAQRKLYRNVMLENYNNLITVGYPFTKPDVIFKL
EQEEEPWVMEEEVLRRHWQGEIWGVDEHQKNQDRLLRQVEVKFQKTLTEEKGNECQKKFA
NVFPLNSDFFPSRHNLYEYDLFGKCLEHNFDCHNNVKCLMRKEHCEYNEPVKSYGNSSSH
FVITPFKCNHCGKGFNQTLDLIRHLRIHTGEKPYECSNCRKAFSHKEKLIKHYKIHSREQ
SYKCNECGKAFIKMSNLIRHQRIHTGEKPYACKECEKSFSQKSNLIDHEKIHTGEKPYEC
NECGKAFSQKQSLIAHQKVHTGEKPYACNECGKAFPRIASLALHMRSHTGEKPYKCDKCG
KAFSQFSMLIIHVRIHTGEKPYECNECGKAFSQSSALTVHMRSHTGEKPYECKECRKAFS
HKKNFITHQKIHTREKPYECNECGKAFIQMSNLVRHQRIHTGEKPYICKECGKAFSQKSN
LIAHEKIHSGEKPYECNECGKAFSQKQNFITHQKVHTGEKPYDCNECGKAFSQIASLTLH
LRSHTGEKPYECDKCGKAFSQCSLLNLHMRSHTGEKPYVCNECGKAFSQRTSLIVHMRGH
TGEKPYECNKCGKAFSQSSSLTIHIRGHTGEKPFDCSKCGKAFSQISSLTLHMRKHTGEK
PYHCIECGKAFSQKSHLVRHQRIHTH
NT seq 2061 nt   +upstreamnt  +downstreamnt
atgactgagtcccagggaacagtaacattcaaagatgtggctatcgacttcactcaggag
gagtggaagagattggatcctgctcagagaaaactgtaccggaatgtgatgctagaaaac
tataacaacttaatcacagtaggctatccgttcaccaaacctgatgtgattttcaaattg
gagcaagaagaagaaccatgggtgatggaggaagaagtattaaggagacactggcaagga
gaaatatggggagttgatgagcatcagaaaaaccaggacagacttttgagacaagttgaa
gttaaattccagaaaacactgactgaagaaaaaggcaatgaatgtcaaaagaaatttgca
aatgtatttcctctgaactctgattttttcccttccagacacaatctctatgagtatgac
ttatttggaaagtgtttagaacataattttgactgtcataataatgtgaaatgccttatg
agaaaggagcattgtgaatataatgaacctgtgaaatcatatggtaatagctcatcccat
tttgtcattaccccctttaagtgtaatcattgtggaaaaggcttcaatcagactttggac
ctcatcagacatctgagaattcatactggagagaagccctatgaatgtagtaactgtaga
aaagccttcagtcacaaggaaaaacttattaaacattataaaattcacagtagggagcag
tcttacaaatgtaatgaatgtggtaaagctttcattaaaatgtcaaatctcattagacat
caaagaattcatactggagagaagccctatgcatgtaaggaatgtgagaagtccttcagc
cagaaatcaaatcttattgatcatgaaaaaattcatactggagagaaaccttatgaatgt
aatgagtgtggaaaagcattcagccagaagcaaagcctcattgcacatcagaaagttcat
actggggagaaaccttatgcatgtaatgaatgtggtaaagccttccctcgaattgcatcc
cttgctcttcatatgagaagtcatacaggagaaaaaccttataaatgtgataaatgtggt
aaagccttctctcagttttccatgcttattatacatgttagaattcatacaggtgaaaaa
ccctatgaatgtaatgagtgtggaaaagccttctctcaaagctcagcccttactgtacat
atgagaagtcacactggtgagaaaccctatgaatgtaaggaatgcagaaaagccttcagc
cacaagaaaaacttcattacacaccagaaaattcatactagagagaaaccttatgagtgt
aatgaatgtgggaaagcttttatacagatgtcaaatcttgttagacaccagagaattcat
actggggaaaaaccctatatatgtaaggaatgtgggaaagcctttagccagaaatcaaat
ctcattgctcatgaaaaaattcattctggagagaaaccctatgaatgcaatgaatgtggt
aaagccttcagccaaaagcaaaacttcattacacatcaaaaagttcatactggagagaaa
ccttatgattgtaatgaatgtggtaaagccttctctcaaattgcatcccttacccttcat
ttgagaagtcatacaggggaaaagccttatgaatgtgataaatgtggtaaagccttctct
cagtgctcactgcttaatttacatatgagaagtcacacaggtgagaagccctatgtatgt
aatgaatgtgggaaagccttctctcaaagaacttcccttattgtgcacatgagaggccat
acaggtgaaaaaccctatgaatgtaataaatgtggaaaagccttctcccaaagctcatcc
cttactatacatatacgaggacatacaggtgagaaacccttcgactgtagtaaatgtgga
aaagccttctctcaaatctcatctcttacccttcatatgagaaaacatacaggtgagaag
ccctatcactgtattgagtgtggcaaggctttcagccaaaagtcgcaccttgttagacac
cagagaattcatactcattag

KEGG   Homo sapiens (human): 148268
Entry
148268            CDS       T01001                                 
Symbol
ZNF570
Name
(RefSeq) zinc finger protein 570
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    148268 (ZNF570)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    148268 (ZNF570)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    148268 (ZNF570)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 KRAB zf-C2H2_jaz Zn-ribbon_8 zf-C2H2_6 Zn_ribbon_SprT zinc_ribbon_15 zf-C2H2_11 C1_4 zf-LYAR
Other DBs
NCBI-GeneID: 148268
NCBI-ProteinID: NP_001308920
HGNC: 26416
Ensembl: ENSG00000171827
Pharos: Q96NI8(Tdark)
UniProt: Q96NI8
LinkDB
Position
19:37467772..37488652
AA seq 536 aa
MAVGLLKAMYQELVTFRDVAVDFSQEEWDCLDSSQRHLYSNVMLENYRILVSLGLCFSKP
SVILLLEQGKAPWMVKRELTKGLCSGWEPICETEELTPKQDFYEEHQSQKIIETLTSYNL
EYSSLREEWKCEGYFERQPGNQKACFKEEIITHEEPLFDEREQEYKSWGSFHQNPLLCTQ
KIIPKEEKVHKHDTQKRSFKKNLMAIKPKSVCAEKKLLKCNDCEKVFSQSSSLTLHQRIH
TGEKPYKCIECGKAFSQRSNLVQHQRIHTGEKPYECKECRKAFSQNAHLVQHLRVHTGEK
PYECKVCRKAFSQFAYLAQHQRVHTGEKPYECIECGKAFSNRSSIAQHQRVHTGEKPYEC
NVCGKAFSLRAYLTVHQRIHTGERPYECKECGKAFSQNSHLAQHQRIHTGEKPYKCQECR
KAFSQIAYLAQHQRVHTGEKPYECIECGKAFSNDSSLTQHQRVHTGEKPYECTVCGKAFS
YCGSLAQHQRIHTGERPYECKECKKTFRQHAHLAHHQRIHIGESLSPPNPVNHQVL
NT seq 1611 nt   +upstreamnt  +downstreamnt
atggctgttgggcttcttaaagccatgtaccaggagttggtgaccttcagagatgtggct
gtagacttctcccaagaggaatgggattgtctggattcttctcaaagacatctgtacagt
aatgtgatgctagagaactacaggatcttggtatcactgggactttgcttttccaaacca
agtgtgatattattgttggaacaaggaaaagcaccctggatggtgaagagagagctgaca
aaaggcttgtgctcaggctgggagcctatatgtgagactgaagaattaaccccaaagcag
gatttttatgaagaacatcaatcccagaagataatagaaacacttacaagctataacctt
gaatactccagtttgagagaagagtggaaatgtgagggctattttgaaaggcaaccaggt
aatcagaaggcgtgtttcaaggaagagataatcactcatgaagaacccctttttgatgag
agagaacaagaatataaatcttggggaagttttcatcagaacccactgctttgtacacaa
aagataatccccaaagaggagaaagtacataaacatgacacacaaaagagaagctttaaa
aaaaatttaatggctattaagcccaagagtgtctgtgcagagaagaaacttttgaaatgt
aatgactgtgaaaaagtcttcagccagagttcatcccttactcttcatcaaagaattcat
actggagagaaaccctataaatgtatagagtgtggaaaagccttcagccagagatcaaat
cttgttcaacatcagaggattcatactggagaaaaaccctatgaatgtaaggaatgtagg
aaagccttcagtcagaatgcacacctagttcaacatctgcgagttcatactggagaaaaa
ccttacgaatgtaaggtatgtcgaaaagccttcagccagtttgcctaccttgctcaacat
cagagagttcacacgggagagaaaccctatgaatgtatcgaatgtgggaaagcatttagc
aacagatcatccattgctcaacaccagagagttcatacaggagagaaaccctatgaatgt
aatgtctgtgggaaagcatttagccttcgtgcataccttactgtacatcagagaatacat
actggagagagaccctatgaatgtaaggaatgtgggaaggcctttagccagaattcacac
cttgctcaacatcagagaattcatactggagaaaaaccttataagtgtcaggaatgtagg
aaagcattcagccagattgcctaccttgctcagcatcaaagagttcatactggagagaaa
ccctatgaatgtattgaatgtgggaaggcttttagcaatgactcgtcccttactcaacat
cagcgagttcatactggagagaaaccttatgaatgtactgtttgtggaaaggcttttagt
tactgtggatcccttgcccaacatcagagaattcatactggagagagaccctatgaatgt
aaggaatgcaaaaaaaccttcaggcagcatgcacaccttgctcatcaccagagaattcac
attggggagtcactgtcaccacccaacccagtcaatcaccaagtcctatag

KEGG   Homo sapiens (human): 152687
Entry
152687            CDS       T01001                                 
Symbol
ZNF595
Name
(RefSeq) zinc finger protein 595
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    152687 (ZNF595)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    152687 (ZNF595)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    152687 (ZNF595)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_6 zf-C2H2_11 zf_UBZ KRAB XPA_N zf-C2H2_jaz Zn-ribbon_8 zinc_ribbon_15 zf-trcl C1_4 PknG_rubred Zn_ribbon_SprT GAGA zf-C2HC_2
Other DBs
NCBI-GeneID: 152687
NCBI-ProteinID: NP_872330
HGNC: 27196
Ensembl: ENSG00000272602
UniProt: Q8IYB9
LinkDB
Position
4:53321..88208
AA seq 648 aa
MELVTFRDVAIEFSPEEWKCLDPAQQNLYRDVMLENYRNLVSLGFVISNPDLVTCLEQIK
EPCNLKIHETAAKPPAICSPFSQDLSPVQGIEDSFHKLILKRYEKCGHENLQLRKGCKRV
NECKVQKGVNNGVYQCLSTTQSKIFQCNTCVKVFSKFSNSNKHKIRHTGEKPFKCTECGR
SFYMSHLTQHTGIHAGEKPYKCEKCGKAFNRSTSLSKHKRIHTGEKPYTCEECGKAFRRS
TVLNEHKKIHTGEKPYKCEECGKAFTRSTTLNEHKKIHTGEKPYKCKECGKAFRWSTSLN
EHKNIHTGEKPYKCKECGKAFRQSRSLNEHKNIHTGEKPYTCEKCGKAFNQSSSLIIHRS
IHSEQKLYKCEECGKAFTWSSSLNKHKRIHTGEKPYTCEECGKAFYRSSHLAKHKRIHTG
EKPYTCEECGKAFNQSSTLILHKRIHSGQKPYKCEECGKAFTRSTTLNEHKKIHTGEKPY
KCEECGKAFIWSASLNEHKNIHTGEKPYKCKECGKAFNQSSGLIIHRSIHSEQKLYKCEE
CGKAFTRSTALNEHKKIHSGEKPYKCKECGKAYNLSSTLTKHKRIHTGEKPFTCEECGKA
FNWSSSLTKHKIIHTGEKSYKCEECGKAFNRPSTLTVHKRIHTGKEHS
NT seq 1947 nt   +upstreamnt  +downstreamnt
atggaactcgtaacattcagggatgtggccatagaattctcccctgaagagtggaaatgt
ctggaccctgcccagcagaatttgtatagagatgtgatgttggagaactacaggaacctg
gtctccctgggttttgtgatctctaacccagacctggtcacctgtctggagcaaataaaa
gagccctgcaatttgaagatacatgagacagcagccaaacccccagctatatgttctcct
ttcagccaagacctttcaccagtgcaggggatagaagattcattccacaaacttatactg
aaaagatacgagaaatgtggacatgagaatttacaattaagaaaaggctgtaaacgtgtg
aatgagtgtaaggtgcagaaaggagttaataatggagtttaccagtgcttgtcaactacc
cagagcaaaatatttcaatgtaatacatgtgttaaagtttttagtaaattttcaaattca
aacaaacataagataagacatactggagagaaaccctttaaatgtacagaatgtggcaga
tcgttttacatgtcacacctaactcaacatacaggaattcatgctggagagaaaccctac
aaatgtgaaaaatgtggcaaagcctttaataggtccacatcacttagtaaacataagaga
attcatactggagagaaaccctacacatgtgaagaatgtggcaaagcctttagacggtcc
acagttctgaacgaacataagaaaattcatactggagagaaaccctacaaatgtgaagaa
tgtggcaaagcctttacaaggtccacaacactgaatgaacacaagaaaattcatactgga
gagaaaccctacaaatgtaaagaatgtggcaaagcctttagatggtccacaagcctgaat
gaacataagaatattcatactggagagaaaccctacaaatgtaaagaatgtggcaaagcc
tttagacagtccaggagcctgaatgaacataaaaatattcatactggcgaaaaaccctac
acatgtgaaaaatgtggcaaagcttttaaccaatcctcaagtcttattatacacaggagc
attcattctgaacaaaaactttacaaatgtgaagaatgtggcaaagcctttacttggtcc
tcatcccttaataaacataagagaattcatactggagagaaaccctacacatgtgaagaa
tgtggcaaagctttttataggtcctcacaccttgctaaacataagagaattcatactgga
gagaaaccctacacgtgcgaagaatgtggcaaagcttttaaccaatcctcaactcttata
ttacacaagagaatccattctgggcaaaaaccttacaaatgtgaagaatgtggcaaagcc
tttacacggtccacaacactgaacgaacataagaaaattcatactggcgagaaaccctac
aaatgtgaagaatgtggcaaagctttcatatggtccgcaagcctgaatgaacataagaat
attcatactggagagaaaccctacaaatgtaaagaatgtggcaaagcttttaaccaatcc
tcaggccttattatacacaggagcattcattctgaacaaaaactttacaaatgtgaagaa
tgtggcaaagcctttactcggtccacagccctgaatgaacataagaaaattcattctgga
gagaaaccctacaaatgcaaagaatgtggcaaagcctataacttatcctcaacccttact
aaacataagagaattcatactggagagaaacccttcacatgtgaagaatgtggcaaagcc
ttcaattggtcctcatcccttactaaacataagataattcatactggagagaaatcctac
aaatgtgaagaatgtggcaaagcttttaatcggccctcaacccttactgtacacaagcga
attcatactggcaaggaacatagttga

KEGG   Homo sapiens (human): 155054
Entry
155054            CDS       T01001                                 
Symbol
ZNF425
Name
(RefSeq) zinc finger protein 425
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    155054 (ZNF425)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    155054 (ZNF425)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    155054 (ZNF425)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_jaz KRAB zf-C2H2_6 zf-met zf-Di19 HypA FYDLN_acid zf-C2HE zinc_ribbon_9
Other DBs
NCBI-GeneID: 155054
NCBI-ProteinID: NP_001001661
OMIM: 619507
HGNC: 20690
Ensembl: ENSG00000204947
Pharos: Q6IV72(Tdark)
UniProt: Q6IV72 A0A090N7U3
LinkDB
Position
7:complement(149102784..149126324)
AA seq 752 aa
MAEPASVTVTFDDVALYFSEQEWEILEKWQKQMYKQEMKTNYETLDSLGYAFSKPDLITW
MEQGRMLLISEQGCLDKTRRTTSPPTDEQLNMKNTGKLLCFDDEGTPRTKEEDCRLNGPQ
KQDLCAALRGKERKILLAQTATFQSPSLRETEILNKKVSITAYDPDKKDLRHKPRETPGR
LEIPTGPRCYSCYVCRKVFQVRRDLLKHKRSHSKSQLCRYPKYKNSSRGKSELRRTQRLL
CQKKRFQCSECEKSYFLKGSLVTHQVVHTGQRPYPCPECDKTFRYRANLKKHLCLHRGER
PFCCGECGRAFVQQCELTEHLRLHSGEKPFQCPQCDRCFRLKRGMKVHLTQHSGKRPFHC
PECGRSFSRKAALKTHQRTHSEEKPFSCGECGRKFIYKIKLDEHIRVHTGEKPFSCPECN
KSFRLKRSLKAHGLQHIGKRPFQCPECSRGFFWRNAMRAHQRLHSEQKPFPCAECGKRFT
RPSKLACHTRVHDRQKEFPCGECKKTFSQQSRLTQHLKVHTTEKPFSCAECGRSFRRRAH
LTEHTRLHSGEEPFQCPECDKSFSWKASMKFHQRMHRDEKPFACGECDKTYTHQSQLTEH
LRLHSGEKPYQCPECEKTFRLKGNLKSHLLQHSGQKPFSCVMCGKSFTQQYRLTEHIRVH
SGEKPFQCPECDKSYCIRGSLKVHLYKHSGERPFQCPECGKGFLQKRSLKAHLCLHSGER
PFSCDECGRSFTYVGALKTHIAVHAKEKPSSL
NT seq 2259 nt   +upstreamnt  +downstreamnt
atggccgagccggcttcggtaactgtgacatttgatgatgtggccttatatttttcggaa
caagagtgggagatcctggagaagtggcagaagcaaatgtataagcaagagatgaagacc
aattacgagacccttgattccctggggtatgctttttccaagccagatttgatcacatgg
atggaacaagggagaatgctattaatcagcgaacagggatgcttagataaaacaagaagg
acaactagccctcctactgatgaacagttgaacatgaagaatactggaaagttgctatgt
tttgatgacgaaggaactcccaggacaaaagaagaggattgccgtttaaatggtcctcaa
aaacaggacttgtgtgctgccttacgagggaaagagagaaagattttattagctcaaaca
gccaccttccagtctccaagtctccgagaaacagagattctaaataaaaaagtcagcatc
acagcatatgatccagacaagaaagacctgcggcataagcctcgggagaccccagggcgc
ttagaaattcccacagggccaagatgctattcctgctatgtctgtaggaaagtcttccaa
gtaaggagggatttgctaaagcacaaacggagccactccaagagccagctctgcagatac
ccaaagtacaaaaactcgtccagagggaagtccgaactcaggcggacgcagaggctcctg
tgtcagaagaagcggttccagtgcagtgagtgtgagaagagctacttcctgaagggcagc
ctcgtcactcatcaggttgtccacaccggccagcggccctacccatgccctgagtgcgac
aagaccttccggtacagggccaacctgaagaagcacctgtgtctacaccgcggggagcgg
ccgttctgctgcggggagtgcggccgggccttcgtgcagcagtgcgagctcacggagcac
ttgcggctgcacagcggagagaagcccttccagtgtccgcagtgtgaccggtgcttccgc
ctgaagaggggcatgaaggtccatctgacccagcacagcgggaagaggcccttccactgt
cccgagtgtggccggagcttctcccggaaggctgccctgaagacccaccagaggacgcac
agcgaggaaaagccgttttcttgtggtgaatgtggcaggaaattcatctacaagattaag
ctggacgagcacatcagagttcacacgggagagaagcccttttcgtgtcccgagtgtaac
aaaagtttccgcctcaagagaagcctgaaagcccacgggctgcagcacattgggaagcgg
cccttccagtgcccggagtgcagcaggggcttcttctggaggaacgccatgcgcgcccac
cagcgcctgcacagcgagcaaaagcccttcccctgcgccgagtgcggcaagcgcttcacg
cggccttccaagctcgcctgccacaccagagtccacgacaggcagaaggagtttccctgc
ggcgagtgcaaaaagaccttttctcagcagtcgcggctcacgcagcacctgaaggtccac
accacggaaaagccgttctcctgcgccgagtgcggccgcagtttccgccgacgcgcgcat
ctcacagagcacacgaggcttcacagtggcgaggagcccttccagtgtcccgagtgcgac
aagagcttctcctggaaggcctccatgaagttccaccagcggatgcacagggacgagaag
cccttcgcgtgcggtgagtgtgacaagacctacacgcatcagtctcagctcaccgagcac
ctgaggctgcacagtggagagaagccctaccagtgtcctgaatgcgagaagactttccgc
ctcaagggaaacctgaaaagccacctgctgcagcacagtggccaaaagccattctcttgt
gtgatgtgcggcaaaagtttcactcaacagtaccggctcacagaacacattcgagtccac
agcggggagaagcccttccagtgtccggagtgtgacaagagctactgcatcaggggcagc
ttgaaggtccacttgtataagcacagtggagagaggcccttccagtgtcccgagtgtggc
aaaggcttcctccagaagagaagcctgaaggcccatctgtgccttcacagtggggagagg
cctttttcttgtgatgagtgtggaaggagcttcacgtacgtgggggcgctcaagacccac
attgcagtgcatgccaaagagaagccctccagcctctag

KEGG   Homo sapiens (human): 155061
Entry
155061            CDS       T01001                                 
Symbol
ZNF746, PARIS
Name
(RefSeq) zinc finger protein 746
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    155061 (ZNF746)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    155061 (ZNF746)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    155061 (ZNF746)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 KRAB zf-met zf-C2H2_6 zf-C2H2_jaz zf-C2H2_11
Other DBs
NCBI-GeneID: 155061
NCBI-ProteinID: NP_689770
OMIM: 613914
HGNC: 21948
Ensembl: ENSG00000181220
Pharos: Q6NUN9(Tbio)
UniProt: Q6NUN9
LinkDB
Position
7:complement(149472696..149497809)
AA seq 644 aa
MAEAVAAPISPWTMAATIQAMERKIESQAARLLSLEGRTGMAEKKLADCEKTAVEFGNQL
EGKWAVLGTLLQEYGLLQRRLENVENLLRNRNFWILRLPPGSKGESPKEWGKLEDWQKEL
YKHVMRGNYETLVSLDYAISKPEVLSQIEQGKEPCNWRRPGPKIPDVPVDPSPGSGPPVP
APDLLMQIKQEGELQLQEQQALGVEAWAAGQPDIGEEPWGLSQLDSGAGDISTDATSGVH
SNFSTTIPPTSWQTDLPPHHPSSACSDGTLKLNTAASTEDVKIVIKTEVQEEEVVATPVH
PTDLEAHGTLFGPGQATRFFPSPAQEGAWESQGSSFPSQDPVLGLREPARPERDMGELSP
AVAQEETPPGDWLFGGVRWGWNFRCKPPVGLNPRTGPEGLPYSSPDNGEAILDPSQAPRP
FNEPCKYPGRTKGFGHKPGLKKHPAAPPGGRPFTCATCGKSFQLQVSLSAHQRSCGAPDG
SGPGTGGGGSGSGGGGGGSGGGSARDGSALRCGECGRCFTRPAHLIRHRMLHTGERPFPC
TECEKRFTERSKLIDHYRTHTGVRPFTCTVCGKSFIRKDHLRKHQRNHAAGAKTPARGQP
LPTPPAPPDPFKSPASKGPLASTDLVTDWTCGLSVLGPTDGGDM
NT seq 1935 nt   +upstreamnt  +downstreamnt
atggccgaggcggtcgcggctccgatttctccgtggacgatggcagccacgattcaggcc
atggagaggaagattgaatcgcaggctgctcgcctgctttccctagaaggtcgaaccggg
atggccgagaagaagctggctgattgcgagaagacagccgtggagttcgggaaccagctg
gagggcaagtgggccgtgctggggaccctgctgcaggagtacgggctgctgcagaggcgg
ctggagaacgtggagaacctgctgcgcaacaggaacttctggatcctgcggctgcccccg
ggcagcaagggggagtcccctaaggagtggggcaagctggaggactggcagaaggagctc
tacaagcacgtgatgaggggcaactacgagacgctggtctccctggactacgccatctcc
aagcccgaggtcctctcccagattgaacaagggaaggagccctgcaactggcgccgccct
ggccccaagattccagatgttcctgtggaccccagtccaggctcggggcccccagttccc
gccccagacctcttgatgcagatcaagcaggagggtgagctccagctccaggagcagcag
gccctgggcgtggaggcgtgggcagccgggcagccagatattggggaggagccctggggc
ctcagccagctggattccggagcaggagacatctccacggatgccacctctggtgtccat
tccaacttttccaccaccatcccgcccacctcctggcaaacggatctccctccccaccat
ccctcttcagcatgctcggacgggaccctgaagctcaacacagcagcctccacggaagat
gtaaaaattgtaataaaaacagaagtccaggaagaggaggtggtggccacacccgtacat
cctactgacctagaggctcacgggaccctgtttggaccaggccaagccacacggttcttc
cctagtcctgcccaggaaggagcctgggaaagccagggcagctccttccccagccaggac
cctgtgctggggctgcgagagcccgcccggcctgagagggacatgggtgagctcagtcct
gctgtggcccaggaggagacccctcctggggactggctcttcggaggggtccggtggggc
tggaatttccggtgtaaaccgccagtgggcctgaacccgaggacggggcccgaggggctt
ccttactcctccccggacaacggagaggccatcttggaccccagccaggccccaaggcca
ttcaacgaaccctgtaaataccctggccggaccaaaggctttggccacaagccagggctg
aagaagcaccccgcggcgccccccgggggccggcccttcacctgcgccacgtgtgggaag
agcttccagctgcaagtcagcctgagcgcgcaccagcgcagctgtggggcgcccgacggg
tcgggcccgggcacaggcggtggcggcagcggcagtggcggcggcggtggcggcagcggt
gggggcagcgcacgggatggcagcgcccttcggtgtggggagtgcggccgttgcttcacg
cgccccgcgcacctcatccgccatcgcatgctgcacaccggcgagcggcccttcccctgc
accgagtgtgagaagcgcttcaccgaacgctccaagctcatcgaccactaccgaacgcac
acgggcgtgcggcccttcacctgcaccgtctgcggcaaaagcttcatccgcaaggaccac
ctccgcaagcaccagcgcaaccatgcagcgggcgccaagaccccggcccgaggccagcca
ctcccgacgccgcccgcacctcctgatcccttcaagagccccgcctccaaaggacctttg
gcctccacagaccttgtgaccgactggacttgtggcctcagcgtcctgggacccaccgat
ggcggggacatgtga

KEGG   Homo sapiens (human): 158431
Entry
158431            CDS       T01001                                 
Symbol
ZNF782
Name
(RefSeq) zinc finger protein 782
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    158431 (ZNF782)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    158431 (ZNF782)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    158431 (ZNF782)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_6 KRAB Zn-ribbon_8 zf-C2H2_jaz zf_UBZ zf-C2H2_11 C1_1 zinc_ribbon_15 zf-C2HC_2 Zn_ribbon_SprT
Other DBs
NCBI-GeneID: 158431
NCBI-ProteinID: NP_001001662
HGNC: 33110
Ensembl: ENSG00000196597
Pharos: Q6ZMW2(Tdark)
UniProt: Q6ZMW2
LinkDB
Position
9:complement(96816164..96933806)
AA seq 699 aa
MNTFQASVSFQDVTVEFSQEEWQHMGPVERTLYRDVMLENYSHLVSVGYCFTKPELIFTL
EQGEDPWLLEKEKGFLSRNSPEDSQPDEISEKSPENQGKHLLQVLFTNKLLTTEQEISGK
PHNRDINIFRARMMPCKCDIAGSACQGLSLMAPHCQYSKEKAHERNVCDKWLISIKDGRT
NTQEKSFAYSKIVKTLHHKEEVIQHQTIQTLGQDFEYNESRKAFLEKAALVTSNSTHPKG
KSYNFNKFGENKYDKSTFIIPQNMNPEKSHYEFNDTGNCFCRITHKTLTGGKSFSQKSHI
REHHRVHIGVKPFEYGKSFNRNSTLPVHQRTHATDKYSDYHPCTETFSYQSTFSVHQKVH
IRAKPYEYNECGKSCSMNSHLIWPQKSHTGEKPYECPECGKAFSEKSRLRKHQRTHTGEK
PYKCDGCDKAFSAKSGLRIHQRTHTGEKPFECHECGKSFNYKSILIVHQRTHTGEKPFEC
NECGKSFSHMSGLRNHRRTHTGERPYKCDECGKAFKLKSGLRKHHRTHTGEKPYKCNQCG
KAFGQKSQLRGHHRIHTGEKPYKCNHCGEAFSQKSNLRVHHRTHTGEKPYQCEECGKTFR
QKSNLRGHQRTHTGEKPYECNECGKAFSEKSVLRKHQRTHTGEKPYNCNQCGEAFSQKSN
LRVHQRTHTGEKPYKCDKCGRTFSQKSSLREHQKAHPGD
NT seq 2100 nt   +upstreamnt  +downstreamnt
atgaacacatttcaggcatcagtgtcattccaggacgtgactgtggaattcagccaggag
gagtggcagcacatgggccctgttgagaggaccctgtacagagatgtgatgctggagaac
tacagccacctcgtctcagtgggctactgctttacaaaaccagaactgatcttcacattg
gaacaaggagaagatccatggttattagagaaagagaaaggatttctaagcaggaactcc
ccagaagactcccaacctgatgaaatctcagagaagagcccagaaaatcaaggcaaacat
ttgttgcaagttttattcaccaataaattattgactacagagcaagaaatttcaggaaaa
ccacataatcgagacataaacatttttcgtgcaagaatgatgccttgtaaatgtgacatt
gcggggtctgcttgccaggggctcagcctgatggccccacactgtcagtattcaaaagaa
aaggctcatgagcgtaatgtttgtgacaaatggctcatcagtattaaggatggcagaact
aacactcaagagaaatctttcgcttatagtaaaattgtgaaaaccctccatcataaggag
gaagttattcaacatcagacaattcagactctggggcaagattttgaatataatgaaagt
agaaaagcttttcttgaaaaggctgcccttgttacatctaacagtacccacccaaaagga
aaatcttacaatttcaataaatttggggaaaacaaatatgataaatcaacctttattatt
cctcagaacatgaatccagagaagagtcactatgagtttaatgatactggaaattgtttc
tgtagaatcactcacaaaactctcacaggagggaaatccttcagccaaaagtcacacatt
agagaacatcatagagttcatataggggtgaaaccctttgaatatggaaaaagtttcaac
cgtaattcaaccctcccagtgcatcagagaactcatgcaacagataaatactctgattat
cacccatgtacagagacattcagctaccagtcaactttcagtgtacatcagaaggttcac
ataagggcaaaaccctatgagtataatgaatgtgggaaatcctgctctatgaattcacac
ttgatttggcctcagaaaagtcacacaggggagaaaccctatgaatgtcctgagtgcggg
aaagccttcagtgagaagtcacgcctaagaaaacatcagagaactcacacgggagagaaa
ccatacaaatgtgatggatgtgataaagctttcagtgcaaagtcaggcctaagaatacac
cagagaacccacacaggggagaaaccattcgaatgtcatgaatgtgggaaatcttttaac
tataagtcaatcctcatagtgcatcagagaactcacacaggggagaaaccttttgaatgt
aatgaatgcgggaaatctttcagccatatgtcaggcctaaggaatcaccgaagaactcac
acaggggaaagaccatataaatgtgatgaatgtgggaaagctttcaaactgaagtcaggc
ctgaggaaacatcatagaacacacacaggggagaagccctacaaatgtaatcagtgtgga
aaagctttcggtcagaaatcacaactcagaggacatcatagaattcacacaggggaaaaa
ccctataaatgtaatcattgtggggaagctttcagtcagaaatcaaacctcagagtacat
cacagaactcatactggggagaaaccctatcaatgtgaggagtgtggaaaaacattcagg
cagaaatcaaatctcagagggcatcagagaactcacactggggagaagccctatgaatgt
aatgaatgtggaaaagctttcagtgagaagtcagtcctaagaaaacatcagcgaactcac
accggggagaaaccatataattgtaatcagtgtggggaagctttcagtcagaaatccaat
ctcagagtacatcagagaactcacacaggggagaaaccctataaatgtgataaatgtggg
agaactttcagtcaaaaatcaagccttagagaacatcagaaagcccacccaggggattaa

KEGG   Homo sapiens (human): 162239
Entry
162239            CDS       T01001                                 
Symbol
ZFP1, ZNF475
Name
(RefSeq) ZFP1 zinc finger protein
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    162239 (ZFP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    162239 (ZFP1)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    162239 (ZFP1)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 KRAB zf-C2H2_6 zf-C2H2_jaz zf-met Zn-ribbon_8 zf_UBZ Zn_ribbon_SprT C1_4 zf-C2H2_11 zf-Di19 Zn_Tnp_IS1595 zinc_ribbon_15 HypA zf-C2H2_8 HVO_2753_ZBP CpXC zf-H2C2_5 zf-C2HE zf-CHY
Other DBs
NCBI-GeneID: 162239
NCBI-ProteinID: NP_001305398
OMIM: 617230
HGNC: 23328
Ensembl: ENSG00000184517
Pharos: Q6P2D0(Tdark)
UniProt: Q6P2D0
LinkDB
Position
16:75119002..75172234
AA seq 407 aa
MNKSQGSVSFTDVTVDFTQEEWEQLDPSQRILYMDVMLENYSNLLSVEVWKADDQMERDH
RNPDEQARQFLILKNQTPIEERGDLFGKALNLNTDFVSLRQVPYKYDLYEKTLKYNSDLL
NSNRSYAGKQTDECNEFGKALLYLKQEKTHSGVEYSEYNKSGKALSHKAAIFKHQKIKNL
VQPFICTYCDKAFSFKSLLISHKRIHTGEKPYECNVCKKTFSHKANLIKHQRIHTGEKPF
ECPECGKAFTHQSNLIVHQRAHMEKKPYECSECGKTFAQKFELTTHQRIHTGERPYECNE
CAKTFFKKSNLIIHQKIHTGEKRYECSECGKSFIQNSQLIIHMRTHTGEKPYECTECGKT
FSQRSTLRLHLRIHTGEKPYECSECGKAFSRKSRLSVHQRVHIGEKP
NT seq 1224 nt   +upstreamnt  +downstreamnt
atgaacaaatcccagggatcagtttcattcacggatgtgactgtggactttacccaggag
gaatgggaacaactggacccctctcagaggatcctatacatggatgtgatgctggagaat
tatagcaacttactttcagtggaagtgtggaaggctgatgaccagatggagagagaccac
agaaacccagacgagcaggcgaggcaatttttaattcttaagaaccaaaccccaattgag
gaaagaggcgatctctttggaaaagcacttaatctgaacacagactttgtttctttaaga
caagtaccttataaatatgacttatatgaaaaaactttgaaatataattcagacttgctt
aatagtaatagaagctatgcaggaaagcagactgatgagtgtaatgaatttggaaaagca
cttctctacctgaagcaagagaaaacccacagtggagtagaatattctgaatacaataaa
agtggaaaagccctcagccataaagcagccatttttaaacatcagaaaataaaaaacttg
gttcaacctttcatttgtacttactgtgacaaggctttctcctttaagtcactcctcatt
agtcataagagaatacatactggagaaaagccatatgaatgcaatgtatgtaagaaaacc
ttctcccataaggccaacctcatcaaacatcagagaattcacactggggagaaacctttc
gagtgtccggaatgtggaaaagctttcacccaccagtcaaacctcattgtacaccagaga
gcacatatggagaagaagccctatgagtgcagtgaatgtggaaagacatttgcccaaaag
tttgaactcaccacacaccagagaattcatacaggagagcgaccctatgagtgtaacgaa
tgtgcaaaaaccttctttaagaagtcaaaccttatcatacatcagaagattcacacgggg
gagaaacgctatgagtgcagtgaatgtggaaaatcctttatccagaactcacagctcatc
atacacatgagaactcatacaggagagaaaccctatgaatgtactgagtgcggcaaaact
ttcagccagaggtcaactcttagattacacttgcgaatccacacaggagagaaaccatat
gagtgttccgaatgtgggaaggcctttagcaggaagtcccgactcagtgtccatcagaga
gttcacatcggggagaaaccctga

KEGG   Homo sapiens (human): 162655
Entry
162655            CDS       T01001                                 
Symbol
ZNF519, HsT2362
Name
(RefSeq) zinc finger protein 519
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    162655 (ZNF519)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    162655 (ZNF519)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    162655 (ZNF519)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 KRAB zf-C2H2_4 zf-C2H2_6 Zn-ribbon_8 zf-C2H2_jaz DUF5830 LIM BolA zinc_ribbon_15 zf-trcl
Other DBs
NCBI-GeneID: 162655
NCBI-ProteinID: NP_660330
HGNC: 30574
Ensembl: ENSG00000175322
Pharos: Q8TB69(Tdark)
UniProt: Q8TB69
LinkDB
Position
18:complement(14071121..14132435)
AA seq 540 aa
MELLTFRDVAIEFSPEEWKCLDPAQQNLYRDVMLENYRNLVSLAVYSYYNQGILPEQGIQ
DSFKKATLGRYGSCGLENICLWKNWESIGEGEGQKECYNLCSQYLTTSHNKHLTVKGDKE
YRIFQKKPQFLSAAPTEPCIPMNKYQHKFLKSVFCNKNQINFNHDSNISKHHSTHFLENY
YNCNECEKVFYQSSKLIFPENIHIQKKPYNSNECGETSDPFSKLTQHQRIYIGESSQRCN
KKCIIVFSQSHLKGHKIINTGEKSVKYKERGKAFTRGLHLGHQKIHTGEKPYKCKKCDKA
FNKSSHLAQHQRIHTGEKPFKCKECGKAFNRGSYLTQHQRIHTGERAFKCEECGKAFNRG
SYLTQHQRIHTGEKPFRCKECGKAFNRSSYVTQHQRMHTGEKPFKCKECGKAFNRASHLT
QHQRIHTGEKHFKCKECGKAFNRGSHLTRHQRIHTGEKSFKCEECGKAFIWGSHLTQHQR
VHTGEKFFKCKECGKAFTRSSHLTQHQRIHTGEKPFKCKECGKAFNRRSTLTQHQIIHTR
NT seq 1623 nt   +upstreamnt  +downstreamnt
atggaactcttaacattcagggatgtggccatagaattctctccagaagagtggaaatgc
ctagaccctgcccaacagaatttatatagagatgtgatgttggagaactacagaaacctc
gtctccctggctgtgtattcttattacaaccaaggcattttaccagagcaaggcatacaa
gattcattcaaaaaagcaacactgggaagatatgggagctgtggccttgaaaatatatgc
ttatggaaaaactgggaaagtataggtgaaggtgaaggacaaaaggaatgttataatcta
tgtagccaatatttgacaactagtcataacaaacatttaactgtgaaaggagacaaagaa
tatagaatatttcagaagaagcctcagtttctgtcagctgctcctacagaaccatgtatt
cctatgaataaatatcaacataaatttttgaaatctgtcttttgtaataaaaatcagata
aattttaaccatgactcaaatattagtaaacatcatagtactcattttctagaaaactat
tacaattgtaatgaatgtgaaaaagtattttaccaatcctcaaagcttattttccctgaa
aatatccatattcaaaaaaagccttacaactctaatgaatgtggtgaaacttctgaccca
ttctcaaagcttactcaacatcaaagaatttatattggagagagctcacaaagatgtaat
aaaaaatgtataatagtctttagtcaatcacatctaaagggacataagataattaacact
ggagaaaaatcagtgaaatataaagaacgtggcaaagcttttaccaggggcttacatctt
ggacatcagaaaattcatactggagagaaaccttacaaatgtaaaaaatgtgacaaagcc
tttaacaagagttcacaccttgctcaacatcagagaatccatactggagagaagcctttc
aagtgtaaggaatgtggcaaagcttttaacagaggctcataccttactcaacatcagaga
atccatactggagagagagctttcaaatgtgaagaatgtggcaaagcctttaacaggggg
tcataccttactcaacaccagagaatccataccggagagaaacctttcagatgtaaggaa
tgtggcaaagcctttaatagaagctcatacgttactcagcatcagagaatgcatactgga
gagaaacctttcaagtgtaaggaatgtggcaaagcttttaacagagcttcacaccttact
caacatcagagaatccatactggagagaaacacttcaaatgtaaagaatgtggcaaagcc
tttaacaggggctcacaccttactcgacatcaaagaatccatactggagagaagtctttc
aaatgtgaagaatgtggcaaagcttttatctggggctcacaccttactcaacatcagaga
gtccatactggagagaaattcttcaaatgtaaagaatgtggcaaagcttttaccaggagc
tcacaccttactcaacatcagagaattcatactggagagaaacctttcaaatgtaaagaa
tgtggcaaagcttttaacagacgctcaacccttactcaacatcaaataattcataccagg
tag

KEGG   Homo sapiens (human): 162962
Entry
162962            CDS       T01001                                 
Symbol
ZNF836
Name
(RefSeq) zinc finger protein 836
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    162962 (ZNF836)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    162962 (ZNF836)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    162962 (ZNF836)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_6 KRAB Zn-ribbon_8 zf-C2H2_11 zf-C2H2_jaz GAGA zinc_ribbon_15 BolA XPA_N zf_UBZ zf-met HalOD2
Other DBs
NCBI-GeneID: 162962
NCBI-ProteinID: NP_001096127
HGNC: 34333
Ensembl: ENSG00000196267
Pharos: Q6ZNA1(Tdark)
UniProt: Q6ZNA1
LinkDB
Position
19:complement(52154107..52171621)
AA seq 936 aa
MALTQGPLTFRDVAIEFSQEEWKSLDPVQKALYWDVMLENYRNLVFLGILPKCMTKELPP
IGNSNTGEKCQTVTLERHECYDVENFYLREIQKNLQDLEFQWKDGEINYKEVPMTYKNNL
NGKRGQHSQEDVENKCIENQLTLSFQSRLTELQKFQTEGKIYECNQSEKTVNNSSLVSPL
QRILPSVQTNISKKYENEFLQLSLPTQLEKTHIREKPYMCKGCGKAFRVSSSLINHQMVH
TTEKPYKCNECGKAFHRGSLLTIHQIVHTRGKPYQCGVCGKIFRQNSDLVNHRRSHTGEK
PYKCNECGKSFSQSYNLAIHQRIHTGEKPYKCNECGKTFKQGSCLTTHQIIHTGEKPYQC
DICGKVFRQNSNLVNHQRIHTGEKPYKCNICGKSFSQSSNLATHQTVHSGNKPYKCDECG
KTFKRSSSLTTHQIIHTGEKPYTCDVCDKVFSQRSQLARHQRSHTGEKPYKCNECGKVFS
QTSHLVGHRRIHTGEKPYKCDKCGKAFKQGSLLTRHKIIHTREKRYQCGECGKVFSENSC
LVRHLRIHTGEQPYKCNVCGKVFNYSGNLSIHKRIHTGEKPFQCNECGTVFRNYSCLARH
LRIHTGQKPYKCNVCGKVFNDSGNLSNHKRIHTGEKPFQCNECGKVFSYYSCLARHRKIH
TGEKPYKCNDCGKAYTQRSSLTKHLIIHTGEKPYNCNEFGGAFIQSSKLARYHRNPTGEK
PHKCSHCGRTFSHITGLTYHQRRHTGEMPYKCIECGQVFNSTSNLARHRRIHTGEKPYKC
NECGKVFRHQSTLARHRSIHTGEKPYVCNECGKAFRVRSILVNHQKMHTGDKPYKCNECG
KAFIERSKLVYHQRNHTGEKPYKCIECGKAFGRFSCLNKHQMIHSGEKPYKCNECGKSFI
SRSGLTKHQTKHTAESLKTKFNVEKPLDVLLTSGFK
NT seq 2811 nt   +upstreamnt  +downstreamnt
atggctcttacacagggacctttgacattcagggatgtagccatagaattctctcaggag
gagtggaaatccctggaccctgtgcagaaagctttgtactgggatgtgatgttggagaac
tacaggaacctggtcttcctgggtatccttcctaaatgtatgaccaaggaattaccacca
atagggaacagtaatacaggagaaaaatgccaaacagtgacgctggaaagacatgaatgt
tatgatgttgaaaatttttacttaagggaaatccagaaaaatctacaggaccttgagttt
caatggaaagatggtgaaataaattataaagaagtgccaatgacctataaaaacaatctt
aatggtaaaagaggtcaacatagtcaagaggatgtagaaaacaaatgtattgaaaatcag
cttacattaagctttcagtcacgtctgactgaactgcagaaatttcaaactgaagggaaa
atttatgagtgtaaccaatctgagaagacagttaataacagttccctagtttcaccactt
caaagaattcttcctagtgtccaaaccaacatttctaaaaaatatgagaatgagtttttg
cagctgtcattacccacccaacttgagaaaacacacattagggaaaaaccttatatgtgt
aaagggtgtggcaaagcctttagagtgtcttcaagtcttattaaccatcagatggtacat
actacagagaaaccttacaaatgcaatgaatgtggcaaagcctttcatcggggctcacta
ctaactatacatcagatagtccatacaagggggaagccatatcaatgtggtgtatgtggc
aagatcttcagacaaaattcagatcttgtaaatcaccggagaagtcacactggagagaaa
ccgtacaaatgtaatgaatgtggcaagtcctttagtcaaagttataaccttgcaatacat
cagagaattcacactggagagaaaccttacaaatgtaatgagtgtgggaaaaccttcaaa
caaggctcatgcctcactacacatcagataatccatacaggagagaaaccatatcaatgt
gatatatgtggcaaggtcttcaggcagaattctaatcttgtaaatcaccagagaatccac
actggagagaaaccatacaaatgcaacatatgtggaaagtcctttagtcaaagttccaac
ctggcaactcatcagacagttcatagtggaaacaaaccttacaaatgtgatgagtgtggc
aaaacctttaaacggagctccagcctcactacacatcagataatccatacaggagagaaa
ccatatacatgtgatgtatgcgacaaggtcttcagtcaacgttcacaacttgcaaggcac
cagagaagtcatactggagagaaaccttacaaatgcaatgaatgtggcaaggtcttcagt
cagacttcacatcttgtggggcatcggagaattcatactggagagaaaccttacaaatgt
gataaatgtggtaaagcctttaaacagggctcattactcactcgacataagataattcat
accagagagaaacgttaccaatgcggtgaatgtggaaaggtctttagtgaaaattcatgc
cttgtaagacatttaagaattcatactggggagcaaccttacaaatgtaatgtgtgtggc
aaggtcttcaattacagtggaaacctttcaattcataagagaatacatacgggagagaaa
cctttccaatgtaatgaatgtggcacagtcttcaggaactactcatgcctagcacgtcat
ctaagaattcatactgggcagaaaccttacaaatgtaatgtgtgtggcaaggtcttcaat
gacagtggaaacctttcaaatcataagagaattcatactggagagaagccgtttcaatgt
aacgaatgcggcaaggttttcagttactactcatgcctagcacgtcatcggaaaattcat
accggagagaaaccttacaaatgtaatgattgtggcaaagcctatactcagcgttcaagc
ctcactaaacatctgataattcatactggagagaaaccttacaattgtaatgagtttgga
ggggcatttatccaaagttcaaaacttgcaagatatcacagaaatcctactggggagaaa
ccacacaaatgtagccattgtggtagaacttttagtcatataacaggcctgacgtaccat
cagagaaggcatactggagagatgccatacaaatgtattgaatgtggccaggtctttaat
tccacttcgaaccttgcaaggcatcggagaattcacactggagagaaaccttacaaatgt
aatgaatgtggcaaggtctttcgtcatcaatcaacactagcacgtcatcggagtattcat
actggagagaaaccttacgtgtgtaatgagtgtggcaaagcctttagagtgcgttcaatt
ctggttaatcatcagaaaatgcatactggggacaaaccttacaaatgtaatgaatgtggt
aaagcttttattgaaaggtcaaagctggtgtaccatcaaagaaatcacactggagagaag
ccatacaaatgtattgaatgtggcaaggcctttgggcggttttcttgcctcaacaaacac
caaatgattcattctggagaaaaaccttataaatgtaatgagtgtggcaaatctttcatt
agtcgctcaggcctcactaaacatcagacaaaacatactgcagagagtcttaaaacaaaa
ttcaatgtggaaaagcctttagatgttctcctaacttctgggttcaaataa

KEGG   Homo sapiens (human): 162963
Entry
162963            CDS       T01001                                 
Symbol
ZNF610
Name
(RefSeq) zinc finger protein 610
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    162963 (ZNF610)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    162963 (ZNF610)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    162963 (ZNF610)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 KRAB Zn-ribbon_8 zf-C2H2_6 zf-C2H2_11 C1_1 zf-C2HE zf-C2H2_jaz zinc_ribbon_15 zf-H2C2_5 zf-met
Other DBs
NCBI-GeneID: 162963
NCBI-ProteinID: NP_001154897
HGNC: 26687
Ensembl: ENSG00000167554
Pharos: Q8N9Z0(Tdark)
UniProt: Q8N9Z0
LinkDB
Position
19:52330221..52367778
AA seq 462 aa
MLCDEEAQKRKAKESGMALPQGRLTFMDVAIEFSQEEWKSLDPGQRALYRDVMLENYRNL
VFLGICLPDLSIISMLKQRREPLILQSQVKIVKNTDGRECVRSVNTGRSCVLGSNAENKP
IKNQLGLTLEAHLSELQLFQAGRKIYRSNQVEKFTNHRSSVSPLQKISSSFTTHIFNKYR
NDLIDFPLLPQEEKAYIRGKSYEYECSEDGEVFRVRASLTNHQVIHTAEKPYKCTECGKV
FSRNSHLVEHWRIHTGQKPYKCSECDKVFNRNSNLARHQRIHTGEKPHKCNECGKAFREC
SGLTTHLVIHTGEKPYKCNECGKNFRHKFSLTNHQRSHTAEKPYKCNECGKVFSLLSYLA
RHQIIHSTEKPYKCNECGRAFHKRPGLMAHLLIHTGEKPYKCNECDKVFGRKLYLTNHQR
IHTGERPYKCNACGKVFNQNPHLSRHRKIHAGENSLRTLQME
NT seq 1389 nt   +upstreamnt  +downstreamnt
atgctatgtgatgaagaagcccagaagaggaaagcaaaggagtcagggatggctcttcct
cagggacgcttgacattcatggacgtggccatcgaattctctcaggaggagtggaaatcc
ctggaccctggacagagggctttatacagggacgtgatgttggagaactacaggaacctg
gtctttctgggaatctgtcttcctgacctaagtattatttccatgttgaagcaaaggaga
gagcccttgattctgcaaagtcaagttaaaatagtaaaaaatacagatggaagggaatgt
gtcagaagcgtgaacacagggaggagctgtgtattgggaagcaatgcagaaaacaagcct
attaaaaatcaacttggattaacccttgaggcacatctgtctgaattgcagctgtttcaa
gccggaaggaaaatttacagaagtaatcaagttgaaaagtttacaaaccatcgttcctca
gtttcaccacttcaaaaaatttcttctagtttcacaacacacatttttaataaatataga
aatgatcttattgatttcccattactcccacaagaagagaaagcatacattagaggaaaa
tcttatgaatatgaatgtagtgaagatggtgaagtttttagagtccgtgcaagccttact
aaccatcaagtaatccatactgcagagaaaccttacaaatgtactgaatgtggcaaggtc
ttcagtcgcaattcacaccttgtagaacattggagaattcatactggacagaagccttac
aaatgtagtgaatgtgacaaggtgtttaatcgcaattcaaaccttgcacgacatcaaaga
attcatactggagagaagcctcacaaatgtaacgaatgtggcaaagcttttagagagtgt
tcgggacttactacccatcttgtaatccatactggagagaaaccttacaaatgtaatgag
tgtggcaagaacttcaggcacaaattttctctaaccaatcatcagagaagtcacacggcg
gaaaaaccttacaaatgtaatgaatgtggcaaggtctttagtctgctttcataccttgca
cggcatcaaataattcatagtacagagaagccctacaaatgtaacgaatgtggaagagca
tttcacaagcgtccgggccttatggcccatcttctaatccatactggagagaaaccttac
aaatgtaatgaatgtgacaaagtctttgggcgcaaattatacctaaccaaccatcagaga
attcatactggagagagaccttacaagtgtaatgcatgtggcaaggtcttcaatcaaaat
ccacacctttcacgacatcggaaaattcatgctggagagaattcactgcgtaccttacag
atggaatga

KEGG   Homo sapiens (human): 162966
Entry
162966            CDS       T01001                                 
Symbol
ZNF600, KR-ZNF1
Name
(RefSeq) zinc finger protein 600
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    162966 (ZNF600)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    162966 (ZNF600)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    162966 (ZNF600)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_6 BolA zf-C2H2_jaz zf-met Zn-ribbon_8 zf-C2H2_11 zf-H2C2_5 zinc_ribbon_15 C1_4
Other DBs
NCBI-GeneID: 162966
NCBI-ProteinID: NP_940859
HGNC: 30951
Ensembl: ENSG00000189190
Pharos: Q6ZNG1(Tdark)
UniProt: Q6ZNG1
LinkDB
Position
19:complement(52764164..52833645)
AA seq 722 aa
MMKEVLSTGQGNTEVIHTGTLQRYQSYHIGDFCFQEIEKEIHDIEFQCQEDERNGHEAPM
TKIKKLTGSTDQHDHRHAGNKPIKDQLGSSFYSHLPELHIIQIKGKIGNQFEKSTSDAPS
VSTSQRISPRPQIHISNNYGNNSPNSSLLPQKQEVYMREKSFQCNESGKAFNCSSLLRKH
QIPHLGDKQYKCDVCGKLFNHKQYLTCHCRCHTGEKPYKCNECGKSFSQVSSLTCHRRLH
TAVKSHKCNECGKIFGQNSALVIHKAIHTGEKPYKCNECDKAFNQQSNLARHRRIHTGEK
PYKCEECDKVFSRKSTLESHKRIHTGEKPYKCKVCDTAFTWNSQLARHKRIHTGEKTYKC
NECGKTFSHKSSLVCHHRLHGGEKSYKCKVCDKAFAWNSHLVRHTRIHSGGKPYKCNECG
KTFGQNSDLLIHKSIHTGEQPYKYEECEKVFSCGSTLETHKIIHTGEKPYKCKVCDKAFA
CHSYLAKHTRIHSGEKPYKCNECSKTFRLRSYLASHRRVHSGEKPYKCNECSKTFSQRSY
LHCHRRLHSGEKPYKCNECGKTFSHKPSLVHHRRLHTGEKSYKCTVCDKAFVRNSYLARH
TRIHTAEKPYKCNECGKAFNQQSQLSLHHRIHAGEKLYKCETCDKVFSRKSHLKRHRRIH
PGKKPYKCKVCDKTFGSDSHLKQHTGLHTGEKPYKCNECGKAFSKQSTLIHHQAVHGVGK
LD
NT seq 2169 nt   +upstreamnt  +downstreamnt
atgatgaaggaggtcttgtcaacagggcaaggcaatacagaagtgatccacacagggaca
ttgcaaagatatcaaagttatcacattggagatttttgcttccaggaaattgagaaagaa
attcatgatattgagtttcagtgtcaagaagatgaaagaaatggccatgaagcacccatg
acaaaaataaaaaagttgactggtagcacagaccaacatgatcacaggcatgctggaaac
aagcctattaaagatcagcttggatcaagcttttattcacatctgcctgaactccacata
attcagatcaaaggtaaaattggtaatcaatttgagaagtctaccagtgatgctccctcg
gtttcaacatcccaaagaatttctcctaggccccaaatccatatttctaataactatggg
aataattccccgaattcttcactactcccacaaaaacaggaagtatacatgagagaaaaa
tctttccaatgtaatgagagtggcaaagcctttaattgtagctcactcttaaggaaacac
cagataccccatttaggagacaaacaatataaatgtgatgtatgtggcaagctctttaat
cacaagcaataccttacatgccattgtagatgtcacactggagagaaaccttacaagtgt
aatgagtgtggaaagtccttcagtcaggtatcatcccttacatgccatcgtagacttcac
actgcagtaaaatctcacaagtgtaatgagtgtggcaagatctttggtcaaaattcagcc
cttgtaattcataaggcaattcatactggagaaaaaccttacaagtgtaatgaatgtgac
aaagcttttaatcagcaatcaaaccttgcacgtcatcgtagaattcatactggagagaaa
ccttacaaatgtgaagaatgtgacaaagttttcagtcggaaatcaacccttgagtcacat
aagagaattcatactggagagaaaccatacaaatgtaaggtttgtgacacagctttcaca
tggaattctcagctggcaagacataaaagaattcacactggagagaaaacttacaagtgt
aatgagtgtggcaagaccttcagtcacaagtcatcccttgtatgccatcatagacttcat
ggtggagagaaatcttacaaatgtaaggtctgtgacaaggcttttgcgtggaattcacac
ctggtaagacatactagaattcatagtggaggaaaaccttacaagtgtaatgaatgtggg
aagacctttggtcaaaattcagatcttctaattcataagtcaattcatactggagagcaa
ccttacaaatatgaagaatgtgaaaaggttttcagttgtggatcaacccttgagacacat
aagataattcacaccggagagaaaccatacaaatgtaaggtttgtgacaaggcttttgcg
tgtcattcctatctggcaaaacatactagaattcatagtggagagaaaccttacaagtgt
aatgagtgcagcaagaccttccgtctgaggtcataccttgcaagccatcgcagagttcat
agtggtgagaaaccttacaagtgtaatgagtgcagcaagaccttcagtcagaggtcatac
cttcattgccatcgtagacttcatagtggtgagaaaccttacaagtgtaatgagtgtggc
aagaccttcagtcacaagccatcccttgttcaccatcgtagacttcatactggagagaaa
tcttacaaatgtacggtttgtgacaaggctttcgtgcgtaattcatacctggcaagacat
accagaattcacactgcagagaaaccttacaagtgtaatgaatgtgggaaggcttttaat
caacaatcacaactttcacttcatcatagaattcatgctggggagaaactttacaaatgt
gaaacatgtgacaaagttttcagtcgcaaatcacaccttaaaagacataggagaattcat
cctggaaagaaaccatacaaatgtaaggtttgtgacaagacttttgggagtgattcacac
ctgaaacaacatactggacttcacactggagagaaaccttacaagtgtaatgagtgtggc
aaagcctttagcaagcagtcaacacttattcaccatcaggcagttcatggtgtagggaaa
cttgactaa

KEGG   Homo sapiens (human): 162967
Entry
162967            CDS       T01001                                 
Symbol
ZNF320, ZFPL
Name
(RefSeq) zinc finger protein 320
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    162967 (ZNF320)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    162967 (ZNF320)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    162967 (ZNF320)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 KRAB zf-C2H2_jaz zf-met zf-C2H2_6 Zn-ribbon_8 zf_UBZ C1_1 zinc_ribbon_15 BolA zf-H2C2_5 Zn_ribbon_SprT DZR zf-RING_15
Other DBs
NCBI-GeneID: 162967
NCBI-ProteinID: NP_997216
OMIM: 606427
HGNC: 13842
Ensembl: ENSG00000182986
Pharos: A2RRD8(Tdark)
UniProt: A2RRD8
LinkDB
Position
19:complement(52859491..52904320)
AA seq 509 aa
MALSQGLLTFRDVAIEFSQEEWKCLDPAQRTLYRDVMLENYRNLVSLDISSKCMMNTLSS
TGQGNTEVIHTGTLQRQASYHIGAFCSQEIEKDIHDFVFQWQEDETNDHEAPMTEIKKLT
SSTDRYDQRHAGNKPIKGQLESRFHLHLRRHRRIHTGEKPYKCEECEKVFSCKSHLEIHR
IIHTGEKPYKCKVCDKAFKHDSHLAKHTRIHRGDKHYTCNECGKVFDQKATLACHHRSHT
GEKPYKCNECGKTFSQTSHLVYHHRLHTGEKPYKCNECGKTFARNSVLVIHKAVHTAEKP
YKCNECGKVFKQRATLAGHRRVHTGEKPYRCEECDKVFSRKSHLERHRRIHTGEKPYKCK
VCDKAFRSDSRLAEHQRVHTGERPYTCNECGKVFSTKAYLACHQKLHTGEKLYECEECDK
VYIRKSHLERHRRIHTGEKPHKCGDCGKAFNSPSHLIRHQRIHTGQKSYKCHQCGKVFSL
RSLLAEHQKIPFGDNCFKCNEYSKPSSIN
NT seq 1530 nt   +upstreamnt  +downstreamnt
atggctctttctcagggtctactgacattcagggatgtggccatagaattctctcaggag
gagtggaaatgcctggaccctgctcagaggactctatacagagacgtgatgctggagaat
tataggaacctggtctccctggatatctcttccaaatgcatgatgaatacattgtcatca
acagggcaaggcaatacagaagtgatccacacagggacattgcagagacaagcaagttat
cacattggagcattttgctcccaggaaattgagaaagacattcatgactttgtgtttcag
tggcaagaagatgaaacaaatgaccatgaagcacccatgacagaaataaaaaagttgact
agtagtacagaccgatatgatcaaaggcatgctggaaacaagcctattaaaggtcagctt
gaatcaagatttcatttgcatttgcgaagacataggagaattcatactggagagaaacct
tacaaatgtgaagaatgtgagaaagttttcagttgcaaatcacatcttgaaatacatagg
ataattcatactggagagaaaccatacaaatgtaaggtttgcgacaaggcttttaagcat
gattcacacctggcaaaacatactagaattcacaggggagacaaacattacacatgtaat
gaatgtggcaaggtttttgatcaaaaagcaacccttgcatgtcatcatagaagtcatact
ggagagaaaccttataagtgtaatgagtgtggcaagacctttagtcagacatcacacctt
gtgtaccatcatagactgcatactggagagaaaccttacaaatgtaatgagtgtggcaag
accttcgctcgaaattcagtcctcgtaattcataaggcagttcatactgcagagaaaccc
tataagtgtaatgaatgtggcaaggtttttaagcaacgagcaactcttgcaggacatcgt
agagttcacactggagagaaaccttacagatgtgaagaatgcgacaaagttttcagtcgc
aaatcacatcttgaaagacataggaggattcatactggagagaaaccatacaaatgtaag
gtttgtgacaaggctttccggagtgattcacgtcttgcagaacatcagagagttcatact
ggagagagaccttacacatgtaatgaatgtggcaaggtttttagtacaaaagcgtacctc
gcatgtcatcaaaaacttcatactggagagaaactttacgaatgtgaagaatgtgacaaa
gtttacattcgcaaatcacaccttgaaagacataggaggattcatacaggagagaaacct
cacaagtgtggtgattgtggtaaagcctttaattcaccttcacaccttattaggcatcag
agaatccatactggacagaaatcttacaaatgtcatcagtgtggcaaggtctttagtctg
aggtcactccttgcagaacatcagaaaattccttttggagacaattgtttcaagtgcaat
gagtatagcaaaccatcaagcattaattga

KEGG   Homo sapiens (human): 162972
Entry
162972            CDS       T01001                                 
Symbol
ZNF550
Name
(RefSeq) zinc finger protein 550
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    162972 (ZNF550)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    162972 (ZNF550)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    162972 (ZNF550)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 KRAB zf-C2H2_4 XPA_N zf-C2H2_jaz Zn-ribbon_8 Zn_ribbon_SprT zf-C2H2_6 zf-met
Other DBs
NCBI-GeneID: 162972
NCBI-ProteinID: NP_001264019
HGNC: 28643
Ensembl: ENSG00000251369
Pharos: Q7Z398(Tdark)
UniProt: Q7Z398
LinkDB
Position
19:complement(57541838..57561395)
AA seq 422 aa
MAETKDAAQMLVTFKDVAVTFTREEWRQLDLAQRTLYREVMLETCGLLVSLGHRVPKPEL
VHLLEHGQELWIVKRGLSHATCAGDRAQVHTREPTTYPPVLSERAFLRGSLTLESSTSSD
SRLGRARDEEGLLEMQKGKVTPETDLHKETHLGKVSLEGEGLGTDDGLHSRALQEWLSAD
VLHECDSQQPGKDALIHAGTNPYKCKQCGKGFNRKWYLVRHQRVHTGMKPYECNACGKAF
SQSSTLIRHYLIHTGEKPYKCLECGKAFKRRSYLMQHHPIHTGEKPYECSQCRKAFTHRS
TFIRHNRTHTGEKPFECKECEKAFSNRAHLIQHYIIHTGEKPYDCMACGKAFRCSSELIQ
HQRIHTGEKPYECTQCGKAFHRSTYLIQHSVIHTGEMPYKCIECGKAFKRRSHLLQHQRV
HT
NT seq 1269 nt   +upstreamnt  +downstreamnt
atggcggagacgaaggacgcagcgcagatgttggtgaccttcaaggatgtggctgtgacc
tttacccgggaggagtggagacagctggacctggcccagaggaccctgtaccgagaggtg
atgctggagacctgtgggcttctggtttcactagggcatcgggttcccaaaccagagttg
gtccacctgctagagcatgggcaggagctgtggatagtgaagagaggcctctcacatgct
acctgtgcaggtgacagagcacaagttcataccagagagccaaccacttacccgccagtc
ttatctgagcgggcctttctccggggaagcctgactctggaatcttcaacctcaagtgat
tcgaggttggggagagctagggatgaggaagggcttttggaaatgcagaaaggtaaagtg
acaccggagacagacctccacaaggagacccatcttgggaaagtgagccttgaaggtgaa
ggtttggggacagatgatggtctgcactccagggcattacaagagtggttatcagcagat
gttctccatgaatgtgactcacagcaaccagggaaagacgccttgattcatgcagggaca
aacccctacaaatgcaagcagtgtgggaaaggttttaacaggaagtggtatctcgttcga
catcagagggttcacactggaatgaaaccctatgaatgcaatgcatgtgggaaagccttt
agccagagctcaactctcattcggcactacctcatccacaccggggagaaaccatacaag
tgccttgagtgtgggaaggccttcaaacgcaggtcgtacctcatgcagcaccatccaatc
cacactggagagaaaccctatgagtgtagtcaatgtcgaaaggccttcacccaccggtct
acttttattcgccataataggacccacactggagaaaagccctttgagtgcaaagaatgt
gagaaagcctttagcaatagagcccacctaattcaacattacatcatccacactggagag
aagccctatgattgcatggcatgtggaaaggccttcagatgcagctcagaactcatacag
caccagcggattcacactggggagaagccctatgaatgcacccagtgtgggaaagccttt
caccggagcacgtacctcattcagcactctgtcatccacactggggagatgccctacaag
tgtatcgagtgtgggaaggccttcaaacgcaggtcacaccttctgcagcaccaaagggtc
catacatga

KEGG   Homo sapiens (human): 162993
Entry
162993            CDS       T01001                                 
Symbol
ZNF846
Name
(RefSeq) zinc finger protein 846
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    162993 (ZNF846)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    162993 (ZNF846)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    162993 (ZNF846)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_6 KRAB XPA_N zf-C2H2_jaz zf-C2H2_11 Zn-ribbon_8 zinc_ribbon_15 zf-trcl zf-BED zf-met Rpr2 DUF6300 zf_C2H2_ZHX zf_Hakai zf-H2C2_5
Other DBs
NCBI-GeneID: 162993
NCBI-ProteinID: NP_001071092
HGNC: 27260
Ensembl: ENSG00000196605
Pharos: Q147U1(Tdark)
UniProt: Q147U1
LinkDB
Position
19:complement(9748619..9786160)
AA seq 533 aa
MDSSQHLVTFEDVAVDFTQEEWTLLDQAQRDLYRDVMLENYKNLIILAGSELFKRSLMSG
LEQMEELRTGVTGVLQELDLQLKTKGSPLLQDISAERSPNGVQLERSNTAEKLYDSNHSG
KVFNEHPFLMTHMITHIGEKTSEDNQSGKALRKNFPHSFYKKSHAEGKMPKCVKHEKAFN
QFPNLTRQNKTHTQEKLCECKDCWRTFLNQSSLKLHIRSHNGDKHYVCKECGKAFSNSSH
LIGHGRIHSGEKPYVCKECGKAFTQSTGLKLHIRTHSGEKPYKCKECGKAFTHSSYLTDH
TRIHSGKKPYVCMECGKAFTRSTGLILHMRIHTGEKPYECKECGKAFIHSSYLTKHVRIH
SGEKLYLCKACGKAFTRSSGLVLHMRTHTGEKPYECKECGKAFNNSSMLSQHVRIHTGEK
PYECKECGKAFTQSSGLSTHLRTHTGEKACECKECGKAFARSTNLNMHMRTHTGEKPYAC
KECGKAFRYSTYLNVHTRTHTGAKPYECKKCGKNFTQSSALAKHLRTKACEKT
NT seq 1602 nt   +upstreamnt  +downstreamnt
atggattcttctcagcacttagtgacctttgaggatgtggctgtggactttacccaggag
gagtggactttgttggatcaagcccagagagatctctacagagatgtgatgttggagaac
tacaagaatctcattatactagcagggtctgaattattcaaacgtagtctcatgtctgga
ttggaacaaatggaagagctgaggacaggagtgacaggagttctgcaggaattggatttg
caactcaaaaccaaaggctccccactgctgcaagatatttctgcagaaagatcaccaaat
ggagtacaattggagagaagcaatactgcagagaaactgtatgactctaaccattctgga
aaagtcttcaatgaacacccatttcttatgactcacatgataactcacattggagagaaa
acttctgaggataatcagagtggaaaagccttaagaaagaactttcctcatagtttttac
aagaaaagtcatgctgaggggaaaatgcctaagtgtgttaaacatgaaaaagccttcaac
cagtttccaaatcttactaggcagaataaaactcacacacaagagaaattgtgtgaatgc
aaagactgttggagaacttttcttaatcagtcatcccttaagttacatataagatctcac
aatggagacaaacactatgtatgtaaggaatgtgggaaagccttcagtaattcctcacac
cttataggacatggaagaattcacagtggagagaagccctatgtctgtaaagaatgtggt
aaagctttcactcaatccacaggacttaaattacacatcagaactcacagtggagaaaaa
ccatataaatgtaaagagtgtgggaaagccttcacccattcttcataccttactgatcat
acaagaatccacagtggaaagaagccctatgtatgtatggaatgtggaaaagccttcact
agatccacaggacttattttacacatgcgaattcacactggagaaaagccatatgaatgt
aaggagtgtggaaaagcttttattcattcctcataccttacaaaacatgtaaggattcac
agtggagagaagctgtatttatgtaaggcatgtgggaaagcttttactcgttcctcagga
cttgttttacacatgagaacacatactggagaaaagccctatgaatgtaaagaatgtggg
aaagcctttaataattcctcaatgcttagtcaacatgtaaggattcacactggagagaag
ccatatgaatgcaaagaatgtgggaaagctttcactcaatcctcgggccttagtacccat
ttaagaactcacactggagaaaaggcctgtgaatgtaaggaatgcggtaaagcatttgct
cgttccacaaatcttaatatgcacatgcgaacgcacacaggagaaaagccttatgcatgt
aaagaatgtgggaaagccttcaggtattccacataccttaacgttcacacacgaactcac
actggagcaaaaccatatgaatgtaagaaatgtgggaaaaacttcactcaatcttcagca
cttgctaaacatctaagaactaaggcatgtgaaaaaacctga

KEGG   Homo sapiens (human): 163049
Entry
163049            CDS       T01001                                 
Symbol
ZNF791
Name
(RefSeq) zinc finger protein 791
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    163049 (ZNF791)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    163049 (ZNF791)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    163049 (ZNF791)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_6 zf-C2H2_jaz KRAB Zn_ribbon_SprT Zn-ribbon_8 zf-trcl zf-C2H2_11 zf_UBZ C1_4 zinc_ribbon_15 zf-met DUF5830 zf-DNA_Pol
Other DBs
NCBI-GeneID: 163049
NCBI-ProteinID: NP_699189
HGNC: 26895
Ensembl: ENSG00000173875
Pharos: Q3KP31(Tdark)
UniProt: Q3KP31
LinkDB
Position
19:12610920..12633834
AA seq 576 aa
MDSVAFEDVSVSFSQEEWALLAPSQKKLYRDVMQETFKNLASIGEKWEDPNVEDQHKNQG
RNLRSHTGERLCEGKEGSQCAENFSPNLSVTKKTAGVKPYECTICGKAFMRLSSLTRHMR
SHTGYELFEKPYKCKECEKAFSYLKSFQRHERSHTGEKPYKCKQCGKTFIYHQPFQRHER
THIGEKPYECKQCGKALSCSSSLRVHERIHTGEKPYECKQCGKAFSCSSSIRVHERTHTG
EKPYACKECGKAFISHTSVLTHMITHNGDRPYKCKECGKAFIFPSFLRVHERIHTGEKPY
KCKQCGKAFRCSTSIQIHERIHTGEKPYKCKECGKSFSARPAFRVHVRVHTGEKPYKCKE
CGKAFSRISYFRIHERTHTGEKPYECKKCGKTFNYPLDLKIHKRNHTGEKPYECKECAKT
FISLENFRRHMITHTGDGPYKCRDCGKVFIFPSALRTHERTHTGEKPYECKQCGKAFSCS
SYIRIHKRTHTGEKPYECKECGKAFIYPTSFQGHMRMHTGEKPYKCKECGKAFSLHSSFQ
RHTRIHNYEKPLECKQCGKAFSVSTSLKKHMRMHNR
NT seq 1731 nt   +upstreamnt  +downstreamnt
atggactcagtggcttttgaggatgtgtctgtgagcttcagccaggaggagtgggctctg
ctggctccttcacagaagaaactctacagagatgtgatgcaggaaacattcaagaacctg
gcatctataggggaaaaatgggaagacccgaatgttgaagatcaacacaaaaaccaagga
cgaaatctaagaagccatacgggagagagactctgtgaaggtaaagaaggtagtcaatgt
gcagaaaacttcagtcccaatctcagtgtgacgaagaagactgccggagtaaaaccatat
gagtgtactatctgtggaaaagccttcatgcgtctctcatcccttactagacacatgagg
tctcacactggatacgagctatttgagaagccatataaatgtaaggagtgtgagaaagcc
tttagttatctcaaatcctttcaaagacatgaaaggagtcacactggagaaaaaccctat
aaatgtaaacaatgtggaaaaaccttcatatatcaccagccctttcaaagacatgagcgg
actcacattggagaaaaaccctatgaatgtaagcaatgtggaaaagctcttagttgttcc
agttcgcttcgagttcatgaaaggattcacactggagaaaagccctatgaatgtaaacaa
tgtgggaaagccttcagttgttccagttctattcgagtacacgaaagaactcacactgga
gagaaaccctatgcatgtaaggaatgtgggaaagccttcatttcccacacaagtgttcta
acacacatgataacacacaacggagatagaccttataaatgcaaagaatgtggaaaggca
ttcatttttcccagttttttacgagtacatgaaagaattcacactggagagaaaccctat
aaatgtaaacaatgtggtaaagccttcagatgttccacctccattcaaattcatgaaaga
attcatactggagagaagccctataaatgtaaagaatgtgggaaatctttcagtgcacgc
ccagcctttcgagtacacgtgagagtgcatactggagagaaaccctataagtgtaaagaa
tgtgggaaagcctttagtagaatcagttactttcgaatacatgaaaggactcacactgga
gagaaaccctacgaatgtaaaaaatgtgggaaaactttcaattatcctctagatttgaaa
atccacaagagaaatcacactggagaaaaaccctatgagtgtaaggaatgtgcaaaaacc
ttcatttctcttgagaactttcgaagacacatgatcacccacactggagacggaccttat
aaatgtagggactgtgggaaggtgttcatttttcctagtgcgttacgaacacatgaaaga
actcacactggagagaaaccctatgaatgtaaacaatgtggaaaagcctttagttgttct
agttacattcggatacataaaagaactcacactggggagaaaccttatgaatgtaaggaa
tgcgggaaggcctttatttatcccacaagctttcaaggacacatgagaatgcatactgga
gagaaaccctataaatgtaaagaatgtgggaaggcctttagtcttcacagttcctttcaa
agacatacaagaattcacaattatgagaaacctcttgaatgtaagcaatgtggaaaagcc
ttcagtgtgtccacatccttaaaaaaacatatgagaatgcacaatcgatag

KEGG   Homo sapiens (human): 163050
Entry
163050            CDS       T01001                                 
Symbol
ZNF564
Name
(RefSeq) zinc finger protein 564
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    163050 (ZNF564)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    163050 (ZNF564)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    163050 (ZNF564)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_6 zf-C2H2_jaz Zn_ribbon_SprT KRAB zf-C2H2_11 Zn-ribbon_8 zf-met zf-trcl zf-C2HC_2 HVO_2753_ZBP C1_4
Other DBs
NCBI-GeneID: 163050
NCBI-ProteinID: NP_659413
HGNC: 31106
Ensembl: ENSG00000249709
Pharos: Q8TBZ8(Tdark)
UniProt: Q8TBZ8
LinkDB
Position
19:complement(12525373..12551482)
AA seq 553 aa
MDSVASEDVAVNFTLEEWALLDPSQKKLYRDVMRETFRNLACVGKKWEDQSIEDWYKNQG
RILRNHMEEGLSESKEYDQCGEAFSQILNLNLNKKIPTIVRPCECSLCGKVFMHHSSLSR
HIRSHLGHKPYDYQEYGEKPYKCKQCGKAFSSCQSFRRHERTHTGEKPYACPECGKAFIS
LPSVRRHMIKHTGDGPYKCQECGKAFDRPSLFQIHERTHTGEKPYECQECAKAFISLPSF
QRHMIRHTGDGPYKCQECGKAFDRPSLFRIHERTHTGEKPHECKQCGKAFISFTNFQSHM
IRHTGDGPYKCKVCGRAFIFPSYVRKHERTHTGEKPYECNKCGKTFSSSSNVRTHERTHT
GEKPYECKECGKAFISLPSVRRHMIKHTGDGPYKCQVCGRAFDCPSSFQIHERTHTGEKP
YECQVCGKAFISLKRIRKHMILHTGDGPYKCQVCGKAFDCPSSVRTHERTHTGEKPYECK
ECGKAFNYASSIRIHERTHTGEKPYECKQCGKTFSYSSSFQRHERAHNGDKPYVKNVGKL
SFITQPSNTCENE
NT seq 1662 nt   +upstreamnt  +downstreamnt
atggactcagtggcctctgaggatgtggctgtgaacttcacacttgaggagtgggctttg
ctggatccttcccagaagaaactctacagagatgtgatgcgggaaacctttagaaacctg
gcctgtgtaggaaaaaaatgggaagaccagagcattgaagattggtacaaaaatcagggg
agaattttaagaaatcatatggaagagggactcagtgaaagtaaagaatatgatcaatgt
ggagaagccttcagtcagattctcaatcttaatctgaacaagaaaattcctactatagta
agaccatgtgaatgtagtttgtgtgggaaagtcttcatgcatcattcatcccttagtagg
cacatcagatctcaccttggacacaaaccatatgactatcaggaatatggagagaaacca
tataaatgtaagcagtgtgggaaagccttcagttcttgtcaatcctttcgaagacatgaa
agaactcacactggtgagaaaccctatgcatgtccggaatgtgggaaagccttcatttct
ctcccaagtgttcgaagacacatgattaagcacactggagatggaccatataaatgtcag
gaatgtgggaaagcctttgatcgcccaagtttatttcagatacatgaaagaactcacact
ggagagaaaccctatgaatgtcaggaatgtgcaaaagctttcatttctcttccaagtttt
caaagacacatgattaggcacactggagatggaccttataaatgtcaggaatgtggaaaa
gcctttgaccgccccagtttatttcgaatacatgaaagaactcatactggagagaaaccc
catgaatgtaaacagtgtgggaaggccttcatttctttcacaaattttcaaagtcatatg
attaggcacactggggatggaccttataaatgtaaagtatgtgggagagcctttattttt
cccagttatgttcgaaagcatgaaagaactcatactggggagaaaccctatgaatgtaat
aaatgtggtaaaaccttcagttcttccagtaatgttcgaacacatgaaaggactcacact
ggagagaagccctatgaatgtaaggaatgcgggaaagccttcatttctctcccaagtgtc
cgaagacacatgataaagcacactggagatggaccttataaatgtcaggtatgtggtaga
gcctttgactgtcccagttcatttcaaatacacgaaagaactcacactggagagaaaccc
tatgaatgtcaggtatgtgggaaagccttcatttctcttaaaaggattagaaaacatatg
atactgcacactggagatggaccttataaatgtcaggtatgtggtaaagcctttgactgt
cctagttctgtccgaacacatgaaagaactcatactggagaaaaaccctatgaatgtaaa
gaatgtgggaaagcattcaattatgccagttccattagaatacatgaaagaactcatacc
ggagaaaaaccctatgaatgtaagcaatgtggaaaaacgttcagttattccagttccttt
caaagacatgaaagagctcataatggagataaaccttacgtaaagaatgtgggaaagctt
tcatttatcacacaaccttcgaatacctgtgaaaatgaatag

KEGG   Homo sapiens (human): 163051
Entry
163051            CDS       T01001                                 
Symbol
ZNF709
Name
(RefSeq) zinc finger protein 709
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    163051 (ZNF709)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    163051 (ZNF709)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    163051 (ZNF709)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2_4 zf-C2H2 KRAB zf-C2H2_6 Zn_ribbon_SprT zf-C2H2_jaz Zn-ribbon_8 zf-C2H2_11 zf-met
Other DBs
NCBI-GeneID: 163051
NCBI-ProteinID: NP_689814
HGNC: 20629
Ensembl: ENSG00000242852
Pharos: Q8N972(Tdark)
UniProt: Q8N972
LinkDB
Position
19:complement(12461184..12484816)
AA seq 641 aa
MDSVVFEDVAVNFTQEEWALLGPSQKKLYRDVMQETFVNLASIGENWEEKNIEDHKNQGR
KLRSHMVERLCERKEGSQFGETISQTPNPKPNKKTFTRVKPYECSVCGKDYMCHSSLNRH
MRSHTEHRSYEYHKYGEKSYECKECGKRFSFRSSFRIHERTHTGEKPYKCKQCGKAFSWP
SSFQIHERTHTGEKPYECKECGKAFIYHTTFRGHMRMHTGEKPYKCKECGKTFSHPSSFR
NHERTHSGEKPYECKQCGKAFRYYQTFQIHERTHTGEKPYQCKQCGKALSCPTSFRSHER
IHTGEKPYKCKKCGKAFSFPSSFRKHERIHTGEKPYDCKECGKAFISLPSYRRHMIMHTG
NGPYKCKECGKAFDCPSSFQIHERTHTGEKPYECKQCGKAFSCSSSFRMHERTHTGEKPH
ECKQCGKAFSCSSSVRIHERTHTGEKPYECKQCGKAFSCSSSFRMHERIHTGEKPYECKQ
CGKAFSFSSSFRMHERTHTGEKPYECKQCGKAFSCSSSFRMHERTHTGEKPYECKQCGKA
FSCSSSIRIHERTHTGEKPYECKQCGKAFSCSSSVRMHERTHTGVKPYECKQCDKAFSCS
RSFRIHERTHTGEKPYACQQCGKAFKCSRSFRIHERVHSGE
NT seq 1926 nt   +upstreamnt  +downstreamnt
atggactcagtggtctttgaggatgtggctgtgaacttcacccaggaggagtgggctttg
ctgggtccctctcagaagaaactctacagagatgtgatgcaagaaacctttgttaacttg
gcctctataggggaaaactgggaggagaagaacattgaagatcacaaaaatcaggggaga
aagctaagaagtcatatggtagagaggctctgtgaaaggaaagaaggtagtcagtttgga
gaaaccatcagtcagactccaaatcctaaaccaaacaagaaaacttttactagagtaaaa
ccatatgaatgtagtgtgtgtggaaaggactatatgtgtcattcatctcttaataggcac
atgagatctcatactgaacatagatcatatgaatatcacaaatatggagagaaatcatat
gaatgtaaggaatgtgggaaaagattcagctttcgaagttcatttcgaatacatgaaaga
actcacactggagagaaaccctataaatgtaaacagtgtggtaaggctttcagttggccc
agttcctttcaaatacatgaaagaactcatactggagagaaaccttatgaatgtaaggaa
tgtgggaaggccttcatttatcacacaacctttcgaggacacatgagaatgcacacaggg
gagaaaccctataaatgtaaagaatgcgggaaaacgttcagtcatcccagttcttttcga
aatcatgaaagaactcactctggagagaaaccctatgaatgtaaacaatgtggaaaagct
ttcagatattaccaaacttttcaaatacatgaaaggactcacactggggaaaaaccctat
cagtgtaagcaatgtggtaaagctcttagttgtcccacatcctttcgaagtcatgaaagg
attcacactggagaaaaaccctataaatgtaaaaaatgtgggaaagccttcagttttcct
agttcctttagaaaacatgaaagaattcatacaggagagaaaccctatgattgtaaggaa
tgtgggaaagcattcatttctcttccaagctatcgaagacatatgataatgcacactgga
aatggaccttataaatgcaaggaatgtgggaaagcctttgattgtcctagttcttttcaa
atccatgaacgaactcacactggagagaaaccctatgaatgtaaacagtgtggtaaagcc
ttcagttgttccagttcctttcgaatgcatgaaagaactcacactggagagaaaccccat
gaatgtaaacaatgtggtaaagccttcagttgttccagttctgttcgaatacatgaaagg
actcacactggagagaaaccctatgaatgtaaacagtgtggtaaagccttcagttgttcc
agttcctttcgaatgcatgaaagaattcacactggagagaaaccctatgaatgtaaacag
tgtggtaaagcctttagtttttctagttcctttcggatgcatgaaaggactcacactgga
gagaaaccctatgaatgtaaacaatgtggtaaagccttcagttgttccagttcctttcga
atgcatgaaaggactcacactggggagaaaccctatgaatgtaaacagtgtggtaaggcg
tttagttgttccagttccattcgaatacatgaaaggactcacactggagagaaaccttat
gagtgtaaacaatgtggtaaggccttcagttgttctagttctgttcgaatgcatgaaagg
actcacactggagtgaaaccctatgaatgtaaacaatgtgacaaagccttcagttgctca
cgttcctttcgaatccatgaacgaactcacactggagagaaaccctatgcatgtcaacaa
tgtggtaaagccttcaagtgttcccgttcctttcgaatacatgaaagagttcatagtgga
gagtaa

KEGG   Homo sapiens (human): 163059
Entry
163059            CDS       T01001                                 
Symbol
ZNF433
Name
(RefSeq) zinc finger protein 433
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    163059 (ZNF433)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    163059 (ZNF433)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    163059 (ZNF433)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 KRAB zf-C2H2_6 zf-C2H2_jaz Zn_ribbon_SprT Zn-ribbon_8 zf_UBZ zinc_ribbon_15 zf-met zf-C2H2_11 zf-MYST
Other DBs
NCBI-GeneID: 163059
NCBI-ProteinID: NP_001073880
HGNC: 20811
Ensembl: ENSG00000197647
Pharos: Q8N7K0(Tdark)
UniProt: Q8N7K0
LinkDB
Position
19:complement(12014715..12035679)
AA seq 673 aa
MMFQDSVAFEDVAVTFTQEEWALLDPSQKNLCRDVMQETFRNLASIGKKWKPQNIYVEYE
NLRRNLRIVGERLFESKEGHQHGEILTQVPDDMLKKTTTGVKSCESSVYGEVGSAHSSLN
RHIRDDTGHKAYEYQEYGQKPYKCKYCKKPFNCLSSVQTHERAHSGRKLYVCEECGKTFI
SHSNLQRHRIMHRGDGPYKCKFCGKALMFLSLYLIHKRTHTGEKPYQCKQCGKAFSHSSS
LRIHERTHTGEKPYKCNECGKAFHSSTCLHAHKRTHTGEKPYECKQCGKAFSSSHSFQIH
ERTHTGEKPYECKECGKAFKCPSSVRRHERTHSRKKPYECKHCGKVLSYLTSFQNHLGMH
TGEISHKCKICGKAFYSPSSLQTHEKTHTGEKPYKCNQCGKAFNSSSSFRYHERTHTGEK
PYECKQCGKAFRSASLLQTHGRTHTGEKPYACKECGKPFSNFSFFQIHERMHREEKPYEC
KGYGKTFSLPSLFHRHERTHTGGKTYECKQCGRSFNCSSSFRYHGRTHTGEKPYECKQCG
KAFRSASQLQIHGRTHTGEKPYECKQCGKAFGSASHLQMHGRTHTGEKPYECKQCGKSFG
CASRLQMHGRTHTGEKPYKCKQCGKAFGCPSNLRRHGRTHTGEKPYKCNQCGKVFRCSSQ
LQVHGRAHCIDTP
NT seq 2022 nt   +upstreamnt  +downstreamnt
atgatgtttcaggattcagtggcctttgaggatgtggctgtgaccttcacccaagaggag
tgggctttgctggatccttcccagaaaaatctctgtagagatgtgatgcaagaaaccttc
aggaacctggcctctatagggaaaaaatggaaaccccagaacatatatgtagagtacgaa
aatctaaggagaaacctaagaattgtgggagagagactctttgaaagtaaagaaggtcat
cagcatggagaaattttgacccaggttccagatgacatgctgaagaaaacaactactgga
gtaaaatcatgcgaaagcagtgtgtatggagaagtaggcagtgctcattcatctcttaat
aggcacatcagagatgacactggacacaaggcatatgagtatcaagaatatggacagaaa
ccatataaatgtaaatactgtaaaaaacctttcaactgtctctcctctgttcagacacat
gaaagggctcatagtggaaggaaactctatgtttgtgaggaatgcggaaaaacatttatt
tcccattcaaaccttcaaagacacaggataatgcaccgtggagatggaccttataagtgt
aaattttgtgggaaagccttgatgtttctcagtttgtatcttatccacaaacgaactcac
actggagagaaaccatatcaatgtaaacagtgtggtaaagcctttagtcattctagtagc
cttcgaatacatgaaagaactcacactggggagaagccttataaatgtaatgaatgtggg
aaagcattccatagttccacatgccttcatgctcataaaagaactcacactggggagaag
ccatatgaatgtaaacagtgtgggaaagccttcagctcttcccattcctttcaaatacat
gaaagaactcacacgggggagaagccatatgaatgtaaggaatgtggaaaagcattcaag
tgtcccagttctgttcgcagacatgaaagaacccactctaggaaaaaaccctatgaatgt
aaacattgtgggaaagtattatcttatcttaccagctttcaaaaccacttgggaatgcac
actggagagatatctcataaatgtaagatatgtgggaaagccttttattctcccagttca
cttcaaacacatgaaaaaactcacactggagagaaaccctataaatgcaaccaatgtggt
aaagcctttaattcttccagttccttccgatatcatgaaagaactcacactggagagaaa
ccttacgagtgtaagcaatgtgggaaagccttcagatctgcctcactccttcaaacacat
ggtaggactcacacgggagagaaaccctatgcatgtaaggaatgtggaaaaccatttagt
aatttctctttctttcaaatacatgaaaggatgcacagagaagagaagccgtatgaatgt
aagggttatgggaaaacattcagtttgcccagtttatttcatagacatgaaaggactcac
actggaggaaaaacctatgaatgcaagcagtgtggcagatccttcaactgttcgagctcc
tttcgatatcatggaaggactcacactggagagaaaccctatgaatgcaagcaatgtgga
aaagccttcagatctgcctcacagcttcaaattcatggaaggactcacactggagagaaa
ccttatgaatgtaagcagtgtgggaaagcctttggatctgcctcacaccttcaaatgcat
ggaaggactcacactggagagaaaccctatgaatgtaagcagtgtgggaagtcttttgga
tgtgcctcgcgacttcaaatgcatggaaggactcacactggagagaaaccgtataaatgt
aagcaatgtgggaaagcttttggatgtccctcaaaccttcgaaggcatggaaggactcac
actggagagaaaccctataaatgtaaccaatgtggtaaagtctttagatgttcttcacaa
cttcaagtgcatggaagggctcactgcatagacaccccataa

KEGG   Homo sapiens (human): 163071
Entry
163071            CDS       T01001                                 
Symbol
ZNF114
Name
(RefSeq) zinc finger protein 114
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    163071 (ZNF114)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    163071 (ZNF114)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    163071 (ZNF114)
SSDB
Motif
Pfam: zf-H2C2_2 KRAB zf-C2H2 zf-C2H2_4 zf-C2H2_11 zf-C2H2_6 zf_UBZ zf-C2H2_jaz zf-trcl zinc_ribbon_15 HVO_2753_ZBP Zn_ribbon_SprT
Other DBs
NCBI-GeneID: 163071
NCBI-ProteinID: NP_001318026
OMIM: 603996
HGNC: 12894
Ensembl: ENSG00000178150
Pharos: Q8NC26(Tdark)
UniProt: Q8NC26
LinkDB
Position
19:48270081..48287608
AA seq 417 aa
MSQDSVTFADVAVNFTKEEWTLLDPAQRNLYRDVMLENSRNLAFIDWATPCKTKDATPQP
DILPKRTFPEANRVCLTSISSQHSTLREDWRCPKTEEPHRQGVNNVKPPAVAPEKDESPV
SICEDHEMRNHSKPTCRLVPSQGDSIRQCILTRDSSIFKYNPVLNDSQKTHENNEDDGVL
GWNIQWVPCGRKTELKSSTWTGSQNTVHHIRDEIDTGANRHQRNPFGKAFREDGSLRAHN
THGREKMYDFTQCENTSRNNSIHAMQMQLYTAETNKKDCQTGATSANAPNSGSHKSHCTG
EKTHKCPECGRAFFYQSFLMRHMKIHTGEKPYECGKCGKAFRYSLHLNKHLRKHVVQKKP
YECEECGKVIRESSKYTHIRSHTGEKPYKCKTCGKDFAKSSGLKKHLKTHKDEKPCE
NT seq 1254 nt   +upstreamnt  +downstreamnt
atgtcccaggactcggtgaccttcgcagacgtggctgtgaacttcaccaaagaggagtgg
accctgctggacccagctcagaggaatctctacagagacgtgatgctggaaaattctagg
aacttggcattcatagattgggcaactccatgtaaaaccaaagacgcaacccctcagccg
gatattcttcctaaaagaacatttcctgaagccaacagagtgtgtctcacgagcatcagt
tcccagcactccacattaagagaagactggagatgccccaaaacagaggaaccacacagg
cagggggtgaataatgtgaagccacctgcagttgcccctgagaaagatgaatctcctgtt
agcatttgtgaagatcatgaaatgaggaaccactctaaacctacctgcaggcttgtgcct
tcacagggagattccataagacaatgtatcctaacacgtgactcaagtattttcaagtat
aatcctgtcttaaacgatagtcaaaaaacacatgaaaacaacgaagacgatggagtcttg
gggtggaacattcagtgggttccgtgtgggagaaaaacagagctgaaatcaagcacatgg
actggcagtcagaacactgtgcatcatatacgtgatgaaattgatacgggggccaacagg
caccagcggaatccatttggaaaagctttccgtgaagacggatcccttagggcacacaac
actcatggtcgagagaaaatgtatgattttactcagtgcgagaacacctccagaaataac
tcaattcacgccatgcagatgcagttgtataccgcagagacaaacaagaaggattgtcaa
actggggcaacctctgccaacgctccaaattccggttcacacaagagtcattgcactgga
gagaaaacccataaatgccccgaatgtgggagagcctttttttatcagtcattccttatg
agacatatgaaaattcacactggagagaaaccgtatgaatgtgggaaatgtgggaaagcc
tttagatattccttacaccttaataaacatttaagaaagcatgttgtgcagaagaagccc
tacgaatgtgaagaatgtgggaaagtcattcgggagtcctcaaaatatacacatataagg
agccacactggagagaaaccctataaatgtaagacatgtggaaaagactttgcaaagtcg
tcaggacttaaaaaacatcttaagactcacaaagatgagaagccctgtgaatga

KEGG   Homo sapiens (human): 163081
Entry
163081            CDS       T01001                                 
Symbol
ZNF567
Name
(RefSeq) zinc finger protein 567
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    163081 (ZNF567)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    163081 (ZNF567)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    163081 (ZNF567)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_6 KRAB Zn-ribbon_8 zinc_ribbon_15 C1_1 HVO_2753_ZBP zf_C2H2_13 Zn_Tnp_IS1595 PHD
Other DBs
NCBI-GeneID: 163081
NCBI-ProteinID: NP_001287908
HGNC: 28696
Ensembl: ENSG00000189042
Pharos: Q8N184(Tdark)
UniProt: Q8N184 B2R956 B4E0D0
LinkDB
Position
19:36666934..36727506
AA seq 647 aa
MAQGSVSFNDVTVDFTQEEWQHLDHAQKTLYMDVMLENYCHLISVGCHMTKPDVILKLER
GEEPWTSFAGHTCLEENWKAEDFLVKFKEHQEKYSRSVVSINHKKLVKEKSKIYEKTFTL
GKNPVNSKNLPPEYDTHGRILKNVSELIISNLNPARKRLSEYNGYGKSLLSTKQETTHPE
VKSHNQSARAFSHNEVLMQYQKTETPAQSFGYNDCEKSFLQRGGLITHSRPYKGENPSVY
NKKRRATNIEKKHTCNECGKSFCRKSVLILHQGIHSEEKPYQCHQCGNAFRRKSYLIDHQ
RTHTGEKPFVCNECGKSFRLKTALTDHQRTHTGEKSYECLQCRNAFRLKSHLIRHQRTHT
GEKPYECNDCGKSFRQKTTLSLHQRIHTGEKPYICKECGKSFHQKANLTVHQRTHTGEKP
YICNECGKSFSQKTTLALHEKTHNEEKPYICSECGKSFRQKTTLVAHQRTHTGEKSYECP
HCGKAFRMKSYLIDHHRTHTGEKPYECNECGKSFSQKTNLNLHQRIHTGEKPYVCNECGK
SFRQKATLTVHQKIHTGQKSYECPQCGKAFSRKSYLIHHQRTHTGEKPYKCSECGKCFRQ
KTNLIVHQRTHTGEKPYVCNECGKSFSYKRNLIVHQRTHKGENIEMQ
NT seq 1944 nt   +upstreamnt  +downstreamnt
atggctcagggatcagtgtctttcaatgatgtgactgtggacttcactcaggaggagtgg
cagcacctggatcatgctcagaagactctatatatggatgtgatgttggaaaactattgc
cacctcatctctgtggggtgtcacatgaccaaacctgatgtgatcctcaagttggaacga
ggagaagagccatggacatcatttgcaggtcatacctgcttggaagaaaactggaaagct
gaagactttttagtgaaattcaaggaacaccaagagaagtattctagatcagttgtaagc
atcaaccacaaaaaactggtgaaggagaagagtaaaatatatgaaaagacatttactcta
ggcaaaaaccctgtgaattcaaaaaatctacctcctgaatatgatactcatggaaggatt
ttgaaaaatgtttcagaattaatcatcagtaatctaaatcctgcaagaaagagacttagt
gagtataatggatatgggaaatcactcctgagtactaaacaagagactactcatcctgaa
gtcaaatcccataatcaaagtgccagagctttcagtcataatgaagttcttatgcagtat
cagaaaacggaaactccagcacagtcatttggatataatgactgtgagaaatcattcctt
caaaggggaggcctgattacacatagtagaccttacaaaggagaaaacccatctgtatat
aataaaaaaagaagagcaaccaatattgaaaaaaaacatacatgcaatgaatgtgggaaa
tctttctgcaggaaatcagtattgattctgcatcagggaattcactcagaagaaaaaccc
tatcaatgtcatcaatgtggaaatgcatttagaaggaaatcatatctcattgatcatcag
agaactcacacaggagagaaaccctttgtttgcaatgaatgtggtaagtccttccgcctc
aagacagccctcactgatcatcagagaacacacacaggggagaaatcgtatgaatgtctg
caatgtaggaatgccttcagattgaagtcacacctcattcgtcatcagagaactcacacg
ggagagaaaccatatgagtgtaatgactgtgggaagtccttccgccagaagacaacactc
tctctacatcagagaatccatacaggtgagaaaccctacatttgtaaagaatgtgggaag
tcctttcaccagaaggcaaatcttactgtacatcagagaactcatacaggggaaaagccc
tatatttgtaatgaatgtgggaaatccttctcccagaagacaacccttgctcttcatgag
aaaactcataatgaggagaaaccctatatttgtagtgaatgtggaaagtccttccgccag
aagacaacccttgtagcacatcagagaacacatacaggggagaaatcttatgaatgtcct
cactgtgggaaggcctttagaatgaagtcatacctcattgatcatcaccgaactcacaca
ggagagaaaccatatgaatgtaatgaatgtggtaaatcattcagtcaaaagacaaatctc
aatctacatcagagaattcatacaggggagaaaccctatgtttgtaatgaatgtgggaag
tcctttcgccagaaagcaaccctcactgtacatcagaaaatacataccggccagaaatcc
tatgaatgtcctcagtgtgggaaagcctttagcaggaagtcatatctcattcatcatcaa
agaactcatacgggagagaaaccatataaatgtagtgaatgtggaaagtgcttccgccag
aagacaaatcttattgtacatcagagaactcacacaggtgagaaaccctatgtttgtaat
gagtgtggtaagtctttcagttataagagaaacctcattgtccatcaaagaactcacaag
ggagaaaacattgaaatgcaataa

KEGG   Homo sapiens (human): 163087
Entry
163087            CDS       T01001                                 
Symbol
ZNF383, HSD17, Zfp383
Name
(RefSeq) zinc finger protein 383
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    163087 (ZNF383)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    163087 (ZNF383)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    163087 (ZNF383)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 KRAB zf-C2H2_6 zf-C2H2_11 zf-C2H2_jaz Zn-ribbon_8 XPA_N zf_UBZ DUF5830 zinc_ribbon_15 Zn_ribbon_SprT Zn_Tnp_IS1595 zf-BED zf-met zf-H2C2_5 C1_4
Other DBs
NCBI-GeneID: 163087
NCBI-ProteinID: NP_001332876
OMIM: 619499
HGNC: 18609
Ensembl: ENSG00000188283
Pharos: Q8NA42(Tdark)
UniProt: Q8NA42
LinkDB
Position
19:37218214..37248740
AA seq 475 aa
MAEGSVMFSDVSIDFSQEEWDCLDPVQRDLYRDVMLENYGNLVSMGLYTPKPQVISLLEQ
GKEPWMVGRELTRGLCSDLESMCETKLLSLKKEVYEIELCQREIMGLTKHGLEYSSFGDV
LEYRSHLAKQLGYPNGHFSQEIFTPEYMPTFIQQTFLTLHQIINNEDRPYECKKCGKAFS
QNSQFIQHQRIHIGEKSYECKECGKFFSCGSHVTRHLKIHTGEKPFECKECGKAFSCSSY
LSQHQRIHTGKKPYECKECGKAFSYCSNLIDHQRIHTGEKPYECKVCGKAFTKSSQLFQH
ARIHTGEKPYECKECGKAFTQSSKLVQHQRIHTGEKPYECKECGKAFSSGSALTNHQRIH
TGEKPYDCKECGKAFTQSSQLRQHQRIHAGEKPFECLECGKAFTQNSQLFQHQRIHTDEK
PYECNECGKAFNKCSNLTRHLRIHTGEKPYNCKECGKAFSSGSDLIRHQGIHTNK
NT seq 1428 nt   +upstreamnt  +downstreamnt
atggctgagggatcagtgatgttcagtgatgtgtccatagacttctctcaggaggagtgg
gactgcctggaccctgttcagagggacttatacagagatgtgatgttggagaactacggc
aatctggtttcaatgggactttacactcctaagcctcaagtgatctccttattggaacaa
gggaaagagccctggatggttggcagagagcttacaagaggcctgtgttcagatctggaa
tcgatgtgtgaaaccaagttattatctctaaagaaggaagtttatgaaatagaattatgc
cagagggagataatgggacttacaaagcatggccttgagtactccagttttggagatgtt
ttggaatatagaagccaccttgcaaaacaactgggatatccaaatgggcattttagtcaa
gaaatattcactcctgaatacatgcccacatttattcaacagacattccttactctccat
caaataattaataatgaagacagaccctatgaatgtaagaaatgtggaaaggcctttagt
cagaactcacaatttattcaacatcagagaattcatattggtgaaaaatcttatgaatgt
aaagagtgtgggaaattctttagttgtggttcacatgttactcggcatctgaaaattcat
actggcgaaaaaccctttgaatgtaaggaatgtggaaaggccttcagttgtagctcatac
ctttctcaacatcagagaatccataccggtaagaaaccctatgaatgtaaggaatgtggg
aaggcctttagttattgctcaaatcttattgaccatcagcgaattcacactggtgaaaaa
ccttatgaatgtaaagtatgtgggaaagcctttactaagagctcacaactttttcagcat
gcacgaattcatacaggtgagaaaccctatgaatgtaaggaatgtggcaaagcctttacc
cagagctcaaagcttgttcaacatcagagaattcatactggtgagaaaccctatgagtgc
aaggaatgtggcaaagcctttagtagtggctcagcacttactaatcatcagagaattcac
actggtgagaaaccctatgattgtaaggaatgtggaaaggcttttactcagagctcacag
cttcgtcaacatcagagaattcacgctggtgagaaaccctttgaatgtcttgaatgtggg
aaggcctttactcagaactcacaacttttccagcatcagagaattcatacagatgaaaaa
ccatatgaatgtaatgaatgtggaaaggcctttaataaatgctcaaaccttactcgacat
ctgagaattcacactggtgaaaagccctataactgtaaggaatgtgggaaggcttttagt
agtggctcggatctcattcgtcatcagggaattcatactaataaataa

KEGG   Homo sapiens (human): 163131
Entry
163131            CDS       T01001                                 
Symbol
ZNF780B, ZNF779
Name
(RefSeq) zinc finger protein 780B
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    163131 (ZNF780B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    163131 (ZNF780B)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    163131 (ZNF780B)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_6 zf-C2H2_jaz KRAB Zn-ribbon_8 zf_UBZ zinc_ribbon_15 Zn_Tnp_IS1595 zf-C2H2_3rep C1_4 zf-C2H2_11
Other DBs
NCBI-GeneID: 163131
NCBI-ProteinID: NP_001005851
HGNC: 33109
Ensembl: ENSG00000128000
Pharos: Q9Y6R6(Tdark)
UniProt: Q9Y6R6 A0A024R0P7
LinkDB
Position
19:complement(40028260..40056231)
AA seq 833 aa
MVHGSVTFRDVAIDFSQEEWECLQPDQRTLYRDVMLENYSHLISLGSSISKPDVITLLEQ
EKEPWIVVSKETSRWYPDLESKYGPEKISPENDIFEINLPKHVIKQISKTLGLEAFYFRN
DSEYRSRFEGRQGHQEGYINQKIISYEEMPAYTHASPIHNTHKPYECKECGKYFSCGSNL
IQHQSIHTGEKPYKCKECGKAFQLHIQLTRHQKFHTGEKTFECKECGKAFNLPTQLNRHK
NIHTVKKLFECKECGKSFNRSSNLTQHQSIHAGVKPYQCKECGKAFNRGSNLIQHQKIHS
NEKPFVCRECEMAFRYHYQLIEHCRIHTGEKPFECKECRKAFTLLTKLVRHQKIHMGEKP
FECRECGKAFSLLNQLNRHKNIHTGEKPFECKECGKSFNRSSNLIQHQSIHADVKPYECK
ECGKGFNRGANLIQHQKIHSNEKPFVCRECEMAFRYHYQLIQHCQIHTGGKPFECKECGK
AFSLLTQLARHKNIHTGEKPFECKDCGKAFNRGSNLVQHQSIHTGEKPYECKECGKAFRL
HLQLSQHEKTHTGEKPFECKECGKFFRRGSNLNQHRSIHTGKKPFECKECGKAFRLHMHL
IRHQKFHTGEKPFECKECGKAFSLHTQLNHHKNIHTGEKPFKCKECGKSFNRVSNLVQHQ
SIHAGVKPYECKECGKGFSRVSNLIQHQKTHSSAKPFVCKECRKTFRYHYQLTEHYRIHT
GEKPFECKECGKAFGLLTQLAQHQIIHTGEKPFKCKECGKAFNRGSNLVQPQSIHTGEKP
YECKECGKAFRLHLQLSLHQKLVQVRNPLNVRNVGQPSDISSNLLNIRKFILG
NT seq 2502 nt   +upstreamnt  +downstreamnt
atggtccatggatcagtgacattcagggatgtggccattgacttctctcaggaggagtgg
gagtgcctgcagcctgatcagaggaccttgtacagggatgtgatgttggagaactacagc
cacctgatatcactgggaagttccatttctaagccagatgtgattacattactagagcaa
gagaaagagccctggattgttgtaagtaaagaaacaagcagatggtatccagatttggag
tcaaaatatggacctgagaaaatatctccagaaaatgatatttttgaaataaatttaccc
aaacatgttataaagcaaataagtaaaacacttggcctcgaggccttttattttagaaat
gactcagaatatagaagtagatttgagggacgacagggacatcaagaaggatatatcaac
cagaagatcatcagctatgaagaaatgcctgcttatactcatgcttctcctattcataat
acacataaaccatatgaatgtaaggaatgtgggaaatactttagttgtggttcaaatctt
attcagcatcagagtattcatactggagagaaaccctataaatgcaaagaatgtgggaaa
gcctttcaacttcacatacaacttactcgacatcagaaatttcatactggtgagaaaact
tttgaatgtaaggaatgtggaaaagcctttaatcttcccacccagcttaatcgccataag
aacattcacacagttaagaaactgtttgaatgtaaggaatgtgggaagtcttttaatcgt
agctcaaaccttactcagcatcaaagtattcatgctggtgtaaaaccatatcaatgtaag
gagtgtgggaaagcctttaatcgtggttcaaatcttattcagcatcaaaaaattcattcc
aatgagaaaccctttgtatgtagggaatgtgagatggcctttcgatatcattaccaactc
attgaacattgccgaattcatactggcgagaaaccctttgaatgtaaagaatgcagaaag
gcctttactcttctgacaaagcttgttcgacatcagaagattcatatgggtgagaagccc
tttgaatgcagggaatgcgggaaggcctttagtctcctcaatcagcttaatcgccataag
aatattcacacaggtgaaaaaccatttgaatgtaaagaatgtgggaagtcctttaatcgt
agttcaaaccttattcaacaccagagtattcatgctgatgtaaaaccatatgaatgtaag
gagtgtgggaaaggctttaatcgtggtgcaaatcttattcagcatcaaaaaattcattcc
aatgagaaaccctttgtatgtagggaatgtgagatggcctttcgatatcattaccaactt
attcaacattgccaaattcatactggtgggaaaccctttgaatgtaaagaatgtggaaag
gcctttagtcttctgacacagcttgctcgacataagaacattcatactggtgagaaacca
tttgaatgtaaagactgtgggaaggccttcaatcgtggctcgaaccttgttcaacatcag
agtattcacactggtgagaagccctatgaatgtaaggagtgtgggaaggcttttagactt
cacctacaactttctcaacatgagaaaactcatacaggtgagaaaccctttgaatgtaag
gaatgtgggaaattctttcgtcgtggttcaaatcttaatcaacatcgaagtattcatacc
ggaaagaaaccctttgaatgtaaggaatgtgggaaagcctttcgacttcatatgcacctt
attcgacatcagaaatttcatactggtgagaagccctttgaatgtaaggaatgtggcaag
gccttcagtcttcacacccagcttaatcaccataagaacattcacacaggtgagaagcca
tttaaatgtaaagaatgtgggaagtcctttaatcgtgtctcaaaccttgttcaacatcag
agtattcatgctggtgtaaaaccatatgaatgtaaggagtgtgggaaaggctttagtcgt
gtttcaaaccttattcagcatcagaaaactcattccagtgcgaaaccctttgtatgtaag
gagtgtaggaagacctttagatatcattaccagcttactgaacattaccgaattcatact
ggtgagaaaccctttgaatgtaaagaatgcggaaaggcctttggtcttctgacacagctt
gctcaacatcagatcattcatactggtgagaagccatttaaatgtaaggagtgtgggaag
gcctttaatcgtggctcaaaccttgttcaacctcagagtattcatactggtgagaaaccc
tatgaatgtaaggagtgtgggaaggcttttagacttcacctacaactttctctgcatcaa
aaacttgtacaggtgagaaaccctttgaatgtaagaaatgtgggacagccttcagacatc
agtagcaacttactgaacatcagaaaattcatacttgggtga

KEGG   Homo sapiens (human): 163223
Entry
163223            CDS       T01001                                 
Symbol
ZNF676
Name
(RefSeq) zinc finger protein 676
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    163223 (ZNF676)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    163223 (ZNF676)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    163223 (ZNF676)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_6 zf-C2H2_jaz zf-C2H2_11 zf_UBZ XPA_N Zn-ribbon_8 zf-trcl Zn_ribbon_SprT zf-C2H2_8 zinc_ribbon_15 KRAB
Other DBs
NCBI-GeneID: 163223
NCBI-ProteinID: NP_001001411
HGNC: 20429
Ensembl: ENSG00000196109
Pharos: Q8N7Q3(Tdark)
UniProt: Q8N7Q3
LinkDB
Position
19:complement(22179089..22260304)
AA seq 588 aa
MLENYRNLVFLGIAAFKPDLIIFLEQGKEPWNMKRHEMVEEPPVICSHFSQEFWPEQGIE
DSFQKMILRRYDKCGHENLHLKISCTNVDECNVHKEGYNKLNQSLTTTQSKVFQCGKYAN
VFHKCSNSNRHKIRHTGEKGLKCKEYVRSFCMLSHLSQHERIYTRENSYKCEENGKAFNW
SSTLTYYKSIHTGEKPYKCEECGKAFSKFSILTKHKVIHTGEKPYKCEECGKAFNRSSIL
TKHKIIHTGEKPYKCEECGKGFSSVSTLNTHKAIHAEEKPYKCEECGKASNSSSKLMEHK
RIHTGEKPYKCEECGKAFSWSSSLTEHKRIHAGEKPYKCEECGKAFNRSSILTKHKIIHT
GEKPYKCEGCGKAFSKVSTLNTHKAIHAEEKPYKCEECGKASNSSSKLMEHKRIHTGEKP
YKCEECGKAFSWSSSLTEHKRIHAGEKPYKCEECGKAFTWSSSFTKHKRIHAAEKPYKCE
ECGKGFSTFSILTKHKIIHTGEKRYKCEECGKAFSWSSILTEHKIIHTGEKPYKCEECGK
AFSRSSSLTRHKRIHTGEKPYKCEECGKAFKSSSTVSYHKKIHTGENP
NT seq 1767 nt   +upstreamnt  +downstreamnt
atgttagagaactacagaaacctggtcttcctgggtattgctgcctttaagccagacctg
atcatttttctggagcaaggaaaagagccctggaatatgaagagacatgagatggtggaa
gaacccccagttatatgttctcatttttcccaagagttttggccagagcaaggcatagaa
gattctttccaaaaaatgatattgagaagatatgacaaatgtggacatgagaatttacac
ttaaaaattagttgtaccaatgtggatgagtgtaacgtgcacaaagaaggttataataaa
cttaaccagagtttaacaactacacagagcaaagtatttcaatgtggcaaatatgcaaac
gtctttcataaatgttcaaattcaaacagacataagataaggcatactggagagaaaggt
ttgaaatgtaaagaatatgtcagatcattttgcatgctttcacacctatctcaacatgaa
agaatttatactagagagaattcctacaaatgtgaagaaaatggcaaagcttttaactgg
tcctcaacccttacttattataagagtattcatactggagagaaaccctacaaatgtgaa
gaatgtggcaaagcctttagtaagttctcaatccttactaaacataaggtaattcatact
ggagagaaaccctacaaatgtgaagaatgtggcaaagcttttaatcgatcctcaatcctt
actaaacataagataattcatactggagagaaaccctacaaatgtgaagaatgtggcaaa
ggatttagtagcgtctcaacccttaatacacataaggcaattcatgctgaagagaagccc
tacaaatgtgaagaatgtggcaaagcttccaactcgtcctcaaagctcatggaacataag
agaattcatactggagagaaaccctacaagtgtgaagaatgtggcaaagccttcagctgg
tcctcaagccttactgaacacaagagaattcatgctggagagaaaccctacaaatgtgaa
gaatgcgggaaagcttttaatcgatcctcaatccttactaaacataagattattcatact
ggagagaaaccctacaaatgtgaaggatgtggcaaagcctttagtaaggtctcaaccctt
aatacacataaggcaattcatgctgaagagaagccctacaaatgtgaagaatgtggcaaa
gcttccaactcatcctcaaagctcatggaacataagagaattcatactggagagaaaccc
tacaagtgtgaagaatgtggcaaagccttcagctggtcctcaagccttactgaacacaag
agaattcatgctggagagaaaccctacaaatgtgaagaatgtggcaaagccttcacctgg
tcctcaagctttactaaacacaagagaattcatgctgcagagaaaccttacaaatgtgaa
gaatgtggcaaaggctttagtacgttctcaatccttactaaacataagataattcatact
ggagagaaacgctacaaatgtgaagaatgtggcaaagccttcagctggtcctcgatcctt
actgaacataagataattcatactggagagaaaccctacaaatgtgaagaatgtggcaaa
gccttcagcagatcctcaagccttactagacacaagagaattcatactggagagaaaccc
tacaaatgtgaagaatgtggcaaagcttttaagtcatcctcaactgttagttatcataag
aaaattcatactggagagaatccctaa

KEGG   Homo sapiens (human): 163227
Entry
163227            CDS       T01001                                 
Symbol
ZNF100
Name
(RefSeq) zinc finger protein 100
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    163227 (ZNF100)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    163227 (ZNF100)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    163227 (ZNF100)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_6 KRAB zf-C2H2_jaz XPA_N zf_UBZ Zn-ribbon_8 zf-AN1 zf-C2H2_11 zinc_ribbon_15 Zn_ribbon_SprT DUF6083
Other DBs
NCBI-GeneID: 163227
NCBI-ProteinID: NP_775802
OMIM: 603982
HGNC: 12880
Ensembl: ENSG00000197020
Pharos: Q8IYN0(Tdark)
UniProt: Q8IYN0
LinkDB
Position
19:complement(21722771..21767579)
AA seq 542 aa
MDDPRYGMCPLKGASGCPGAERSLLVQSYFEKGPLTFRDVAIEFSLEEWQCLDSAQQGLY
RKVMLENYRNLVFLAGIALTKPDLITCLEQGKEPWNIKRHEMVAKPPVICSHFPQDLWAE
QDIKDSFQEAILKKYGKYGHDNLQLQKGCKSVDECKVHKEHDNKLNQCLITTQSNIFQCD
PSAKVFHTFSNSNRHKIRHTRKKPFKCKKCEKSFCMLLHLTQHKRFHITENSYQCKDCGK
AFNWFSTLTTHRRIHTGEKPYKCEECGKAFNRSSHLTTHKIIHTGEKPYRCEECGKAFNR
SSHLTTHKRIHTGVKPYKCTECGKAFNRSSHLTTHRIIHTGEKPYKCEECGKAFNQSSTL
TTHKITHAGEKPYKCEECGKAFYRFSYLTKHKTSHTGEKFYKCEECGKGFNWSSALTKHK
RIHTGEKPYKCEECGKAFNESSNLTTHKMIHTGEKPYKCDECGKAFNRSSQLTAHKMIHT
GEKPYKCEECGKAFNRSSTLTKHKITHTGEKSYKWEECGKDFNQSLSLIKQNNSYWRETL
QM
NT seq 1629 nt   +upstreamnt  +downstreamnt
atggatgacccgaggtatggaatgtgtcctctcaagggagcaagtggatgccctggggct
gagaggagtcttctggtgcagtcttattttgaaaaggggccattgacgtttagggatgtg
gccatagaattctctctggaggagtggcaatgcctggacagtgctcagcagggtttgtat
aggaaagtgatgttagagaactacagaaacctggtcttcttggcaggtattgctctcact
aagccagacctgatcacctgtctggagcaaggaaaagagccctggaatataaagagacat
gagatggtagccaaacccccagttatatgttctcattttccccaagacctttgggcagag
caggacattaaagattcttttcaagaagcgattctgaaaaaatatggaaaatatggacat
gacaatttacagttacaaaaaggctgtaaaagtgtggatgagtgtaaagtgcacaaagaa
catgataacaaattaaaccagtgtttgataactacccagagcaacatatttcaatgtgat
ccatctgcaaaagtctttcatacattttcaaattcaaacagacataagataagacatact
agaaagaaacctttcaaatgtaaaaaatgtgaaaaatcattttgcatgcttttacaccta
actcaacataaaagatttcatattacagagaattcctaccaatgtaaagattgtggcaaa
gccttcaactggttctcaacccttactacacacaggagaattcatactggagagaaaccc
tacaaatgtgaagaatgtgggaaagcatttaaccggtcctcacaccttactacacataag
ataattcatactggagagaaaccatacagatgtgaagaatgtgggaaagcttttaaccgg
tcttcacaccttactacacataaaagaattcatactggagtgaaaccctacaaatgtaca
gaatgtggcaaagcttttaaccggtcctcacaccttactacacacaggataattcatact
ggagagaaaccctacaaatgtgaagaatgtggcaaagcctttaaccagtcctcaaccctt
actacacataagataactcatgctggagagaaaccttacaaatgtgaagaatgtggcaaa
gctttttaccgattctcataccttactaaacataagacaagtcatactggagagaaattc
tacaaatgtgaagaatgcggcaaaggctttaactggtcctcagccctcactaaacataag
agaattcatactggagagaaaccctacaaatgtgaagaatgtggcaaagcttttaatgag
tcctcaaaccttactacccataagatgattcatactggagagaaaccctacaaatgtgac
gaatgtggcaaagcctttaaccggtcctcacaactaactgcacataagatgattcatact
ggagagaaaccctacaaatgtgaggaatgtggcaaagcttttaaccgatcctcaaccctt
actaaacataagataactcatactggagagaaatcttacaaatgggaagaatgtggtaaa
gactttaaccagtccctaagccttattaaacaaaataactcatactggagagaaacccta
caaatgtga

KEGG   Homo sapiens (human): 163255
Entry
163255            CDS       T01001                                 
Symbol
ZNF540, Nbla10512
Name
(RefSeq) zinc finger protein 540
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    163255 (ZNF540)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    163255 (ZNF540)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    163255 (ZNF540)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 KRAB zf-C2H2_6 Zn-ribbon_8 zf_UBZ zf-C2H2_jaz XPA_N C1_4 zf-C2H2_11 zinc_ribbon_15 zf-C2H2_3rep
Other DBs
NCBI-GeneID: 163255
NCBI-ProteinID: NP_001165696
OMIM: 613903
HGNC: 25331
Ensembl: ENSG00000171817
Pharos: Q8NDQ6(Tbio)
UniProt: Q8NDQ6
LinkDB
Position
19:37551374..37614179
AA seq 660 aa
MAHALVTFRDVAIDFSQKEWECLDTTQRKLYRDVMLENYNNLVSLGYSGSKPDVITLLEQ
GKEPCVVARDVTGRQCPGLLSRHKTKKLSSEKDIHEISLSKESIIEKSKTLRLKGSIFRN
EWQNKSEFEGQQGLKERSISQKKIVSKKMSTDRKRPSFTLNQRIHNSEKSCDSHLVQHGK
IDSDVKHDCKECGSTFNNVYQLTLHQKIHTGEKSCKCEKCGKVFSHSYQLTLHQRFHTGE
KPYECQECGKTFTLYPQLNRHQKIHTGKKPYMCKKCDKGFFSRLELTQHKRIHTGKKSYE
CKECGKVFQLIFYFKEHERIHTGKKPYECKECGKAFSVCGQLTRHQKIHTGVKPYECKEC
GKTFRLSFYLTEHRRTHAGKKPYECKECGKSFNVRGQLNRHKTIHTGIKPFACKVCEKAF
SYSGDLRVHSRIHTGEKPYECKECGKAFMLRSVLTEHQRLHTGVKPYECKECGKTFRVRS
QISLHKKIHTDVKPYKCVRCGKTFRFGFYLTEHQRIHTGEKPYKCKECGKAFIRRGNLKE
HLKIHSGLKPYDCKECGKSFSRRGQFTEHQKIHTGVKPYKCKECGKAFSRSVDLRIHQRI
HTGEKPYECKQCGKAFRLNSHLTEHQRIHTGEKPYECKVCRKAFRQYSHLYQHQKTHNVI
NT seq 1983 nt   +upstreamnt  +downstreamnt
atggcccatgcattggtgacgttcagggatgtggctatagacttctctcagaaggaatgg
gagtgcctggacactacccagaggaaattgtacagagatgtgatgttggagaattataat
aacttggtctcactgggatattctggctcaaagccagatgtgattaccttactggagcaa
gggaaagagccctgcgtggtggcgagggatgtgacaggaagacagtgccccggtttgtta
tccaggcataagaccaagaaattatcttcagaaaaggacattcatgaaatcagtttatcc
aaagagagtataatagaaaaaagtaaaactcttcgtctgaaaggatccatttttagaaat
gagtggcagaacaaaagtgagtttgagggtcaacagggacttaaagaaagatctatcagt
caaaagaaaatcgtctctaaaaaaatgtcaactgatagaaaacgtccctcttttactctg
aatcagagaattcacaatagtgagaaaagctgtgactcacacttggttcaacatgggaaa
atagattctgatgtgaaacatgattgtaaagaatgtgggagtacttttaataatgtctat
cagcttactctccatcagaaaattcatactggtgaaaaatcctgtaaatgtgagaaatgt
gggaaagtttttagtcatagctatcaacttactctgcatcagagatttcatactggtgag
aaaccctatgaatgtcaagaatgtgggaagacctttactctttacccacaacttaatcga
catcagaaaattcacactggtaaaaaaccctatatgtgtaagaaatgtgataagggtttt
tttagtagattagaacttactcaacataaaagaattcatactggtaagaaatcttatgaa
tgtaaagaatgtggaaaagtttttcaacttattttctactttaaagaacatgagagaatt
catacaggtaagaaaccctatgaatgtaaggagtgtgggaaagcttttagtgtatgcgga
caacttacccgtcatcagaaaattcatactggtgtaaaaccctacgaatgtaaggaatgt
ggaaagacctttagacttagtttttaccttactgaacacagaagaactcatgcaggtaag
aaaccttatgaatgtaaggagtgtgggaaatcatttaatgtgcgtggacagcttaatcgg
cataaaacaatccatactggtataaaaccttttgcatgtaaggtgtgtgagaaggctttt
agttatagtggtgacctcagagtacattctagaattcatactggagagaaaccatatgaa
tgtaaggaatgcgggaaagcctttatgcttcgttcagtccttactgaacatcagagactt
catactggtgtgaagccctacgaatgtaaggaatgtgggaagacctttcgagttcgttct
caaattagtctacataagaaaattcatactgatgtgaagccctacaaatgtgtacgatgt
gggaagacctttagatttggtttctaccttactgaacaccagagaattcacactggtgaa
aagccctataaatgtaaagaatgtggaaaggcctttattcgtagagggaatcttaaagaa
catctgaaaattcattctggtttaaaaccctatgactgtaaagaatgtgggaagtccttt
agtcggcgtgggcagttcactgaacatcagaaaattcatacgggtgtaaaaccatacaaa
tgtaaagaatgtgggaaggcctttagtcgtagtgtagaccttagaatacatcaaagaatt
catactggtgagaaaccctatgagtgtaaacaatgtgggaaggcctttagacttaattca
caccttactgaacatcagagaattcacactggtgagaaaccctatgagtgtaaggtatgt
agaaaggcctttagacaatattcacatctttatcaacatcagaaaactcataatgtaatt
taa

KEGG   Homo sapiens (human): 168417
Entry
168417            CDS       T01001                                 
Symbol
ZNF679
Name
(RefSeq) zinc finger protein 679
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    168417 (ZNF679)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    168417 (ZNF679)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    168417 (ZNF679)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 KRAB zf-C2H2_4 zf-C2H2_11 zf_UBZ zf-C2H2_jaz Zn-ribbon_8 zf-trcl C1_4 zf-C2H2_6 zf-met Zn_ribbon_SprT CpXC zf-H2C2_5 PknG_rubred
Other DBs
NCBI-GeneID: 168417
NCBI-ProteinID: NP_699194
HGNC: 28650
Ensembl: ENSG00000197123
Pharos: Q8IYX0(Tdark)
UniProt: Q8IYX0
LinkDB
Position
7:64228474..64266931
AA seq 411 aa
MAKRPGSPGSREMGLLTFRDVVIEFSLEEWQCLDHAQQNLYRDVMLENYRNLVSLGIAVS
KPDLITCLEQNKEPWNIKRNEMVTKHPVMCSHFTQDLPPELGIKDSLQKVIPRRYGKSGH
DNLQVKTCKSMGECEVQKGGCNEVNQCLSTTQNKIFQTHKCVKVFGKFSNSNRHKTRHTG
KKHFKCKKYGKSFCMVSQLHQHQIIHTRENSYQCEECGKPFNCSSTLSKHKRIHTGEKPY
RCEECGKAFTWSSTLTKHRRIHTGEKPYTCEECGQAFSRSSTLANHKRIHTGEKPYTCEE
CGKAFSLSSSLTYHKRIHTGEKPYTCEECGKAFNCSSTLKKHKIIHTGEKPYKCKECGKA
FAFSSTLNTHKRIHTGEEPYKCEECDKAFKWSSSLANHKSMHTGEKPYKCE
NT seq 1236 nt   +upstreamnt  +downstreamnt
atggctaaaagaccgggatcccctggaagccgagaaatgggactgttgacattcagagat
gtagtcatagaattctctctggaggagtggcaatgcctggatcacgctcagcagaattta
tatagagatgtgatgttagagaactacagaaacctggtctccctgggtattgctgtctct
aagccagacttgatcacctgtctggagcaaaataaagagccttggaatataaagagaaat
gagatggtaaccaaacacccagttatgtgttctcatttcacccaagaccttccgccagag
ctaggcataaaagattcactccaaaaagtaataccaagaagatatggaaaaagtggacat
gacaatttacaagtaaaaacatgtaaaagcatgggtgagtgtgaggtgcaaaaaggaggt
tgtaatgaagttaaccaatgtttgtcaactacccaaaacaaaatatttcagactcataaa
tgtgtcaaagtcttcggcaaattttcaaattccaatagacataagacaagacatactgga
aagaaacatttcaaatgtaaaaaatatggcaaatcattttgcatggtttcacaactacat
caacatcagataattcatactagggagaattcctaccaatgtgaagaatgcggcaaaccc
ttcaactgctcttcaaccctttctaaacataaaagaattcatactggagagaaaccctac
agatgtgaggaatgtggcaaagcttttacctggtcctcaacccttactaaacataggaga
attcatactggagaaaaaccctacacatgtgaagaatgtggccaagcctttagccgctcc
tcaacacttgctaaccacaagagaattcatactggagagaaaccatacacatgtgaagaa
tgtggcaaagcctttagcttatcctcatccctcacttaccacaagagaattcatactgga
gagaaaccctacacatgtgaagaatgtggcaaagcctttaactgctcctcaacccttaag
aaacataagataattcatactggagagaaaccctacaaatgtaaagaatgtgggaaagcc
tttgccttctcctcaactcttaatactcataagaggattcatactggagaggaaccctac
aaatgtgaagaatgtgacaaagcttttaagtggtcctcaagtcttgctaatcataagagt
atgcatactggagagaaaccctacaaatgtgaataa

KEGG   Homo sapiens (human): 169270
Entry
169270            CDS       T01001                                 
Symbol
ZNF596
Name
(RefSeq) zinc finger protein 596
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    169270 (ZNF596)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    169270 (ZNF596)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    169270 (ZNF596)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 KRAB zf-C2H2_jaz zf-C2H2_6 Zn-ribbon_8 GAGA zf-C2H2_11 zf-met Zn-C2H2_12
Other DBs
NCBI-GeneID: 169270
NCBI-ProteinID: NP_001035880
HGNC: 27268
Ensembl: ENSG00000172748
Pharos: Q8TC21(Tdark)
UniProt: Q8TC21
LinkDB
Position
8:232137..247340
AA seq 504 aa
MPSPDSMTFEDIIVDFTQEEWALLDTSQRKLFQDVMLENISHLVSIGKQLCKSVVLSQLE
QVEKLSTQRISLLQGREVGIKHQEIPFIQHIYQKGTSTISTMRSHTQEDPFLCNDLGEDF
TQHIALTQNVITYMRTKHFVSKKFGKIFSDWLSFNQHKEIHTKCKSYGSHLFDYAFIQNS
ALRPHSVTHTREITLECRVCGKTFSKNSNLRRHEMIHTGEKPHGCHLCGKAFTHCSDLRK
HERTHTGEKPYGCHLCGKAFSKSSNLRRHEMIHTREKAQICHLCGKAFTHCSDLRKHERT
HLGDKPYGCLLCGKAFSKCSYLRQHERTHNGEKPYECHLCGKAFSHCSHLRQHERSHNGE
KPHGCHLCGKAFTESSVLKRHERIHTGEKPYECHVCGKAFTESSDLRRHERTHTGEKPYE
CHLCGKAFNHSSVLRRHERTHTGEKPYECNICGKAFNRSYNFRLHRRVHTGEKPYVCPLC
GKAFSKFFNLRQHERTHTKKAMNM
NT seq 1515 nt   +upstreamnt  +downstreamnt
atgccatcaccggattccatgaccttcgaggatatcattgtagacttcactcaagaagag
tgggccctgctggacacatcccagagaaagctgtttcaagatgtgatgttggagaacatc
agtcatctggtctctattggcaaacagctctgcaaatcagttgtgctttcccaattggag
caagtagagaaactttcaacacaaagaataagcttactgcaaggtagagaagttggcatt
aaacatcaagagataccattcattcaacatatctatcagaagggcacgtccaccatcagc
acaatgagatctcatactcaagaggatccttttctatgcaatgacttaggagaagatttc
actcaacatatagcattgactcaaaatgtgattacctacatgagaacgaaacactttgta
agcaaaaagtttgggaaaatcttcagtgactggttatcctttaatcaacacaaggaaatt
cacaccaaatgtaaatcatatggaagtcatctatttgattatgcctttatccaaaactct
gcccttagaccacacagtgtgactcacactagagagataacattggaatgtcgtgtgtgt
gggaaaacctttagcaaaaattctaatcttaggcgacatgagatgattcacactggagag
aaaccacacggatgtcatctatgtgggaaagcctttactcattgctctgatcttcgaaaa
catgagagaactcacactggagagaagccatatggatgtcatctatgtgggaaagccttc
agtaaaagttctaaccttagacgacatgagatgattcacactagagaaaaagcacagata
tgccatctatgtgggaaagccttcactcattgctctgaccttagaaaacatgagagaact
cacttaggagataaaccatatggatgtctcctatgtgggaaggctttcagtaaatgttct
taccttagacaacatgaaagaactcacaatggagagaaaccatatgaatgtcatctatgt
ggaaaagccttctctcattgttctcaccttagacaacatgagcgaagtcacaatggagag
aaaccacatggatgtcatctatgtgggaaagcattcactgaatcttctgtgcttaaacga
catgagagaattcacactggagagaaaccatatgagtgccatgtatgtgggaaagccttc
actgaatcttctgacctcagacgacatgagagaactcacactggagaaaaaccatatgaa
tgccatctatgcggaaaagccttcaatcactcttctgtccttagacgacatgagagaact
cacactggagagaaaccatatgaatgcaatatatgtggtaaagccttcaatagaagttac
aactttagacttcatagaagagttcacactggagagaaaccatatgtatgtcctctatgt
gggaaagcctttagtaaattttttaaccttagacaacatgagagaactcacactaaaaaa
gcaatgaatatgtaa

KEGG   Homo sapiens (human): 169841
Entry
169841            CDS       T01001                                 
Symbol
ZNF169
Name
(RefSeq) zinc finger protein 169
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    169841 (ZNF169)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    169841 (ZNF169)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    169841 (ZNF169)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 KRAB Zn-ribbon_8 Zn_ribbon_SprT DZR zf-C2H2_6 DUF3268 zf-C2H2_11 zf-Di19 HVO_2753_ZBP zf-UBP zinc_ribbon_9 PHD zf-trcl zf-C2HC_2
Other DBs
NCBI-GeneID: 169841
NCBI-ProteinID: NP_919301
OMIM: 603404
HGNC: 12957
Ensembl: ENSG00000175787
Pharos: Q14929(Tbio)
UniProt: Q14929
LinkDB
Position
9:94259298..94301829
AA seq 603 aa
MSPGLLTTRKEALMAFRDVAVAFTQKEWKLLSSAQRTLYREVMLENYSHLVSLGIAFSKP
KLIEQLEQGDEPWREENEHLLDLCPEPRTEFQPSFPHLVAFSSSQLLRQYALSGHPTQIF
PSSSAGGDFQLEAPRCSSEKGESGETEGPDSSLRKRPSRISRTFFSPHQGDPVEWVEGNR
EGGTDLRLAQRMSLGGSDTMLKGADTSESGAVIRGNYRLGLSKKSSLFSHQKHHVCPECG
RGFCQRSDLIKHQRTHTGEKPYLCPECGRRFSQKASLSIHQRKHSGEKPYVCRECGRHFR
YTSSLTNHKRIHSGERPFVCQECGRGFRQKIALLLHQRTHLEEKPFVCPECGRGFCQKAS
LLQHQSSHTGERPFLCLECGRSFRQQSLLLSHQVTHSGEKPYVCAECGHSFRQKVTLIRH
QRTHTGEKPYLCPQCGRGFSQKVTLIGHQRTHTGEKPYLCPDCGRGFGQKVTLIRHQRTH
TGEKPYLCPKCGRAFGFKSLLTRHQRTHSEEELYVDRVCGQGLGQKSHLISDQRTHSGEK
PCICDECGRGFGFKSALIRHQRTHSGEKPYVCRECGRGFSQKSHLHRHRRTKSGHQLLPQ
EVF
NT seq 1812 nt   +upstreamnt  +downstreamnt
atgtcaccaggactcctgacaaccaggaaggaggcattgatggccttccgggatgtggct
gtggccttcacccagaaggagtggaagctattgagttctgctcagaggaccctgtacagg
gaggtgatgctggagaactacagccatctggtctccctgggaattgcattttccaaacca
aaactcatcgaacagctggagcaaggcgacgaaccttggagagaggagaacgaacatctt
ctggacctttgtccagagcctagaacagaattccagccaagttttccccacctggtggcc
ttttctagctcgcagctcctcagacaatatgcgctaagtggccatcccacacagatcttc
ccaagctcatctgcaggaggtgacttccaactagaagctccaagatgctctagtgaaaaa
ggagaaagtggagagacagaaggccccgacagctcattaagaaagaggccaagcagaatt
tctaggacattcttcagcccacatcaaggtgacccagtagaatgggtagaagggaacaga
gaaggaggaacagaccttcgcctggcccaaaggatgagtcttggggggtcagacacaatg
ttgaagggagcagacacttcagaatctggagcagtcatacgtggaaactatagactggga
cttagcaaaaagtcaagcctgttcagccaccagaagcatcatgtgtgccctgaatgcggg
agaggcttttgccagagatcagaccttatcaagcaccagaggacacacaccggggagaag
ccatacctgtgtcctgagtgtgggcgtcggtttagccagaaggcctccctctccatacac
cagaggaagcactcgggggagaagccgtatgtgtgcagggaatgtgggcgacacttcagg
tatacatcctctctcactaatcacaagaggattcactccggggagaggccctttgtatgt
caggagtgtgggcgaggctttcgccagaagatagccctccttctacaccagaggacgcac
ttggaggagaagcccttcgtgtgtcctgagtgtgggagaggcttttgccagaaggcatca
ctcctccagcaccagagctcacacacaggggagaggcccttcctgtgccttgagtgtggg
cgtagcttcaggcagcagtcactcctccttagtcaccaggtcacacactcaggagagaag
ccttatgtctgtgctgagtgtgggcacagctttcgccaaaaggtcactctcatcaggcac
cagaggacacacacaggggagaagccttacctgtgcccccagtgtgggcggggttttagc
cagaaggtcaccctcattggacaccagaggacacacacaggggagaagccctacctgtgc
cctgattgtgggcgtggctttggtcagaaggtcaccctcatcagacaccagaggacacac
acaggggagaagccttatctgtgccccaagtgtgggcgtgcatttggctttaagtcgctc
ctcacccgacaccagaggacacactcagaggaggagctttacgtagacagggtgtgtgga
caaggacttggccagaagtcacaccttatctctgaccaaaggacacactcaggagagaag
ccctgcatttgcgatgaatgtgggcgcggctttggctttaagtctgccctcatccgacat
cagcggacccattctggggagaagccgtatgtctgcagggagtgtgggcgtggctttagc
cagaagtctcacttgcatagacacaggaggaccaagtctggtcatcagctcctaccccaa
gaggtcttctga

KEGG   Homo sapiens (human): 170959
Entry
170959            CDS       T01001                                 
Symbol
ZNF431, ZFP932
Name
(RefSeq) zinc finger protein 431
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    170959 (ZNF431)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    170959 (ZNF431)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    170959 (ZNF431)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 KRAB zf-C2H2_6 zf-C2H2_jaz XPA_N zf_UBZ zf-C2H2_11 Zn-ribbon_8 BolA zf-AN1 zinc_ribbon_15 Zn_ribbon_SprT
Other DBs
NCBI-GeneID: 170959
NCBI-ProteinID: NP_597730
OMIM: 619505
HGNC: 20809
Ensembl: ENSG00000196705
Pharos: Q8TF32(Tdark)
UniProt: Q8TF32 A0A024R7Q8
LinkDB
Position
19:21142040..21196053
AA seq 576 aa
MDDLKYGVYPLKEASGCPGAERNLLVYSYFEKETLTFRDVAIEFSLEEWECLNPAQQNLY
MNVMLENYKNLVFLGVAVSKQDPVTCLEQEKEPWNMKRHEMVDEPPAMCSYFTKDLWPEQ
DIKDSFQQVILRRYGKCEHENLQLRKGSASVDEYKVHKEGYNELNQCLTTTQSKIFPCDK
YVKVFHKFLNANRHKTRHTGKKPFKCKKCGKSFCMLLHLSQHKRIHIRENSYQCEECGKA
FKWFSTLTRHKRIHTGEKPFKCEECGKAFKQSSTLTTHKIIHTGEKPYRCEECGKAFNRS
SHLTTHKIIHTGEKPYKCEECGKAFNQSSTLSTHKFIHAGEKPYKCEECDKAFNRFSYLT
KHKIIHTGEKSYKCEECGKGFNWSSTLTKHKRIHTGEKPYKCEVCGKAFNESSNLTTHKM
IHTGEKPYKCEECGKAFNRSPQLTAHKIIHTGEKPYKCEECGKAFSQSSILTTHKRIHTG
EKPYKCEECGKAFNRSSNLTKHKIIHTGEKSYKCEECGKAFNQSSTLTKHRKIHTRQKPY
NCEECDNTFNQSSNLIKQNNSYWRETLQMSRMWESL
NT seq 1731 nt   +upstreamnt  +downstreamnt
atggacgacttgaaatatggagtgtatcctctcaaggaagcaagtggatgccctggggct
gagaggaatcttctagtttactcttattttgaaaaggagacattgacatttagggatgtg
gccatagaattctctctggaggagtgggaatgcctgaaccctgctcagcagaatttatat
atgaatgtgatgttagaaaactacaaaaacctggtcttcttgggtgttgctgtctctaag
caagacccagtcacctgtctggagcaagaaaaagagccctggaatatgaagagacatgag
atggtggatgaacccccagctatgtgttcttattttaccaaagacctttggccagagcaa
gacataaaagattcttttcaacaagtaatactgagaagatatggcaaatgtgaacatgag
aatttacagttaagaaaaggctccgcaagtgtagatgagtataaggtgcacaaagaaggt
tataatgagctaaaccagtgtttgacaactacccagagcaaaatatttccatgtgataaa
tatgtgaaagtctttcataaatttttaaatgcaaatagacataagacaagacatactgga
aagaaacctttcaaatgtaaaaaatgtggcaaatcattttgcatgcttttacacctaagt
caacataaaagaattcatattagagagaattcttaccaatgtgaagaatgtggcaaagct
tttaaatggttctcaacccttactagacacaagagaattcatactggagagaaacccttc
aaatgtgaagaatgtggcaaagcttttaagcagtcctcaacccttactacacataagata
attcatactggggagaaaccatatagatgtgaagaatgtggcaaagccttcaaccggtcc
tcacaccttactacacataagataattcatactggagagaagccctacaaatgtgaagaa
tgtggcaaagcttttaaccagtcttcaacccttagtacacataagttcattcatgctgga
gagaaaccctacaaatgtgaggaatgtgacaaagcttttaatcgattctcataccttact
aaacataagataattcatactggagaaaaatcttacaaatgtgaagaatgtggcaaaggc
tttaattggtcctcaacccttactaaacataaaagaattcatactggagagaaaccctac
aaatgtgaagtgtgtggcaaagcctttaatgagtcctcaaaccttactacacataagatg
attcatactggagagaaaccctacaaatgtgaagaatgtggcaaagcttttaaccggtcc
ccacaacttactgcacataagataattcatactggagagaaaccttacaaatgtgaagaa
tgtggcaaagcttttagccagtcatcaatccttactacacataagagaattcacactgga
gagaaaccctacaaatgtgaagaatgtggcaaagcttttaaccgatcctcaaatcttact
aaacataagataattcatacaggagagaaatcttacaaatgtgaagaatgtggtaaagcc
tttaaccaatcctcaactcttactaaacataggaaaattcatactagacagaaaccctac
aactgtgaagaatgtgacaatacatttaaccagtcctcaaaccttattaaacaaaataat
tcatactggagagaaactctacaaatgtcaagaatgtgggaaagcctttaa

KEGG   Homo sapiens (human): 170960
Entry
170960            CDS       T01001                                 
Symbol
ZNF721
Name
(RefSeq) zinc finger protein 721
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    170960 (ZNF721)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    170960 (ZNF721)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    170960 (ZNF721)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_6 zf-C2H2_11 XPA_N zf_UBZ zf-C2H2_jaz Zn-ribbon_8 GAGA C1_4 zinc_ribbon_15 DZR zf-trcl KRAB Zn_ribbon_SprT LIM
Other DBs
NCBI-GeneID: 170960
NCBI-ProteinID: NP_597731
HGNC: 29425
Ensembl: ENSG00000182903
Pharos: Q8TF20(Tdark)
UniProt: Q8TF20
LinkDB
Position
4:complement(439988..499156)
AA seq 923 aa
MLENYRNLVSLAMCSHFTQDFLPVQGIEDSFHKLILRRYEKCGHDNLQLRKGCKSMNVCK
VQKGVYNGINKCLSNTQSKIFQCNARVKVFSKFANSNKDKTRHTGEKHFKCNECGKSFQK
FSDLTQHKGIHAGEKPYTCEERGKDFGWYTDLNQHKKIHTGEKPYKCEECGKAFNRSTNL
TAHKRIHNREKAYTGEDRDRAFGWSTNLNEYKKIHTGDKPYKCKECGKAFMHSSHLNKHE
KIHTGEKPYKCKECGKVISSSSSFAKHKRIHTGEKPFKCLECGKAFNISTTLTKHRRIHT
GEKPYTCEVCGKAFRQSANLYVHRRIHTGEKPYTCGECGKTFRQSANLYVHRRIHTGEKP
YKCEDCGKAFGRYTALNQHKKIHTGEKPYKCEECGKAFNSSTNLTAHKRIHTREKPYTCE
DRGRAFGLSTNLNEYKKIHTGDKPYKCKECGKAFIHSLHLNKHEKIHTGKKPYKCKQCGK
VITSSSSFAKHKRIHTGEKPFECLECGKAFTSSTTLTKHRRIHTGEKPYTCEVCGKAFRQ
SAILYVHRRIHTGEKPYTCEECGKTFRQSANLYVHRRIHTGEKPYKCEECGKAFGRYTDL
NQHKKIHTGEKLYKCEECGKDFVWYTDLNQQKKIYTGEKPYKCEECGKAFAPSTDLNQHT
KILTGEQSYKCEECGKAFGWSIALNQHKKIHTGEKPYKCEECGKAFSRSRNLTTHRRVHT
REKPYKCEDRGRSFGWSTNLNEYKKIHTGDKLYKCKECGKVFKQSSHLNRHEKIHTGKKP
YKCKECGKVITSSSSFAKHKRIHTGEKPFKCLECGKAFTSSTTLTKHRRIHTGEKPYTCE
ECGKAFRQSAILYVHRRIHTGEKPYTCGECGKTFRQSANLYAHKKIHTGEKPYTCGDCGK
TFRQSANLYAHKKIHTGDKTIQV
NT seq 2772 nt   +upstreamnt  +downstreamnt
atgttggagaactacagaaacctggtctccctagctatgtgttctcatttcacccaagac
tttttgccagtgcaggggatagaagattcattccacaaacttatactgagaagatatgag
aaatgtgggcatgataatttacaattaaggaaaggctgtaaaagtatgaacgtgtgtaaa
gtgcagaagggagtttataatggaattaataaatgcttgtcaaatactcagagcaaaata
tttcaatgtaatgcacgtgtcaaagtttttagtaaatttgcaaattcaaacaaagataag
acaagacatactggagagaaacactttaaatgtaacgaatgtggcaagtcatttcagaag
ttctcagacctaactcaacataaaggaattcatgctggagagaaaccctacacttgtgaa
gaacgtggcaaagactttggatggtacacagacctgaatcaacacaagaaaattcatact
ggagagaaaccttacaaatgtgaagaatgtggcaaagcctttaataggtcaacaaacctt
actgcacataagagaattcacaacagagagaaagcttacacaggtgaagatcgtgacaga
gcctttggatggtccacaaacctgaatgaatataagaaaattcatactggagataaaccc
tacaaatgtaaagaatgtgggaaagcctttatgcattcctcacacctgaataaacatgag
aaaattcatactggagagaaaccctacaaatgtaaggaatgtggcaaagtcatttcctca
tcctcaagctttgctaaacataagaggattcatactggcgagaaaccctttaaatgttta
gaatgtggtaaagcctttaatatttccacaacccttactaaacataggagaattcatact
ggagagaaaccctacacatgtgaagtatgtggcaaagcctttagacagtccgcaaacctt
tatgtacataggagaattcatactggagagaaaccctacacatgtggagaatgtggcaaa
acctttagacagtccgcaaacctttacgtacataggagaattcatactggagagaaacct
tacaaatgcgaagactgtggcaaagcctttggacggtacacagccctgaatcaacacaag
aaaattcatactggagagaaaccttacaaatgtgaagagtgtggcaaagcctttaatagt
tcaacaaaccttactgcacataagagaattcacaccagagagaaaccctacacatgtgaa
gatcgtggcagagcctttggattgtccacaaacctgaatgaatataagaaaattcatact
ggagataaaccctacaaatgtaaagaatgtgggaaagcctttatacattccttgcacctg
aataaacatgagaaaattcatactggaaagaaaccctacaaatgtaagcaatgtggcaaa
gtcattacctcatcctcaagctttgctaaacataagaggattcatactggcgagaaaccc
tttgaatgtttagaatgtggtaaagcgtttactagttccacaacccttactaaacatagg
agaattcatactggagagaaaccctacacatgtgaagtatgtggcaaagcctttagacag
tccgcaatcctttatgtacataggagaattcatactggagagaaaccctacacatgtgaa
gaatgtggcaaaacctttagacagtccgcaaacctttatgtacataggagaattcatact
ggagagaaaccttacaaatgtgaagagtgtggcaaagcctttggacggtacacagacctg
aatcaacacaagaaaattcatactggagagaaactttacaaatgtgaagagtgtggcaaa
gactttgtatggtacacggacctgaatcaacagaagaaaatttacactggggagaaacct
tacaaatgtgaagagtgtggcaaagcctttgccccatcaacagacctgaatcaacacacg
aaaattcttactggagagcaaagttacaaatgtgaagagtgtggcaaagcctttggatgg
tccatagccctgaatcaacacaagaaaattcatactggagaaaaaccttacaaatgtgaa
gagtgtggcaaagcctttagtaggtcaagaaaccttactacacataggagagttcacact
agggagaaaccctacaaatgtgaagatcgtggcagatcctttggatggtccacaaacctg
aacgaatataagaaaattcatactggagataaactctacaaatgtaaagaatgtgggaaa
gtgtttaaacagtcctcacacctgaatagacatgagaaaattcatactggaaagaaaccc
tacaaatgtaaggaatgtggcaaagtcattacgtcatcctcaagctttgctaaacataag
aggattcatacaggtgagaaaccctttaaatgtttagaatgtggtaaagcgtttactagt
tccacaacccttactaaacataggagaattcatactggagagaaaccctacacatgtgaa
gaatgtggcaaagcctttagacagtcagcaatcctttatgtacataggagaattcatact
ggagagaaaccctacacatgtggagaatgtggcaaaacctttagacagtctgcaaatctt
tatgcgcataagaaaattcatactggagagaaaccctacacgtgtggagactgtggcaaa
acctttagacagtctgcaaatctttatgcacataagaaaattcatactggagataaaacc
atacaagtgtaa

KEGG   Homo sapiens (human): 171392
Entry
171392            CDS       T01001                                 
Symbol
ZNF675, TBZF, TIZ
Name
(RefSeq) zinc finger protein 675
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    171392 (ZNF675)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    171392 (ZNF675)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    171392 (ZNF675)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_6 KRAB zf-C2H2_jaz zf_UBZ XPA_N Zn-ribbon_8 Zn_ribbon_SprT zinc_ribbon_15 End_beta_propel zf-AN1
Other DBs
NCBI-GeneID: 171392
NCBI-ProteinID: NP_612203
HGNC: 30768
Ensembl: ENSG00000197372
Pharos: Q8TD23(Tbio)
UniProt: Q8TD23
LinkDB
Position
19:complement(23652801..23687212)
AA seq 568 aa
MGLLTFRDVAIEFSLEEWQCLDTAQRNLYKNVILENYRNLVFLGIAVSKQDLITCLEQEK
EPLTVKRHEMVNEPPVMCSHFAQEFWPEQNIKDSFEKVTLRRYEKCGNDNFQLKGCKSVD
ECKLHKGGYNGLNQCLPTMQSKMFQCDKYVKVFNKFSHSDRHKIKHMENKPFKCKECGRS
FCMLSHLTRHERNYTKVNFCKCEECEKAVNQSSKLTKHKRIYTCEKLYKCQECDRTFNQF
SNLTEYKKDYAREKPYKCEECGKAFNQSSHLTTHKIIHTGEKPYKCEECGKAFNQFSNLT
THKKIHTGEQPYICEECGKAFTQSSTLTTHKRIHTGEKPYKCEECGKAFNRSSKLTEHKN
IHTGEQPYKCEECGKAFNRSSNLTEHRKIHTEEKPYKCKECGKAFKHSSALTTHKRIHTG
EKPYKCEECGKAFNRSSKLTEHKKLHTGKKPYKCEECGKAFIQSSKLTEHKKIHSGEIPY
KCEECGKAFKHSSSLTTHKRIHTGEKPYKCEECGKAFSRSSKLTEHKIIHTGEKPYKCER
CDKAFNQSANLTKHKKIHTGEKLQNWNV
NT seq 1707 nt   +upstreamnt  +downstreamnt
atgggactgttgacatttagggatgtggccatagaattctctctggaagaatggcaatgc
ctggacactgcacagcggaatttatataaaaatgtgattttagagaactacagaaacctg
gtcttcctgggtattgctgtctctaagcaagacctgatcacctgtctggagcaagaaaaa
gagcctttgactgtgaagagacatgagatggtgaatgaacccccagtaatgtgttctcat
tttgcccaagagttttggccagagcagaacataaaagattcttttgaaaaagtgacactg
agaagatatgaaaaatgtggaaatgataattttcagttaaaaggctgtaaaagtgtggat
gaatgtaagttgcacaagggaggttataatggacttaaccaatgtttaccaactatgcag
agcaaaatgtttcaatgtgataaatatgtgaaagtctttaataaattttcacattcagat
agacataagataaaacatatggaaaataaacctttcaaatgtaaagaatgtggcagatca
ttttgcatgctttcacacctaactcgacatgaaagaaattataccaaggtgaatttctgc
aaatgtgaagaatgtgaaaaagctgttaaccaatcttcaaagcttactaaacataaaaga
atttatacttgtgagaaactctacaaatgtcaagaatgtgacagaacttttaaccaattc
tcaaaccttactgaatataaaaaagattatgctcgagagaaaccatacaaatgtgaagaa
tgtggcaaagcctttaaccagtcctcacaccttactacacataagataattcatacagga
gagaaaccctacaaatgtgaagaatgtggcaaagcctttaaccagttctcaaatcttact
acacataaaaaaattcatactggagagcaaccctacatatgtgaagaatgtggcaaggct
tttacccaatcctcaacccttactacacataagagaattcatactggagaaaaaccctac
aaatgtgaagaatgtggaaaagcttttaaccgatcctcaaaacttactgaacataaaaac
attcatactggagagcaaccctacaaatgtgaggaatgcggcaaagcttttaaccgatcc
tcaaatcttacggaacataggaaaattcataccgaagagaaaccctacaaatgtaaagaa
tgtggcaaagcttttaaacactcctcagcccttactacacataagagaattcacactgga
gagaaaccctacaaatgtgaagaatgtggcaaagcttttaaccgatcctcaaaacttact
gaacataagaaacttcatactggaaagaaaccctacaaatgtgaagaatgtggcaaagct
tttatccaatcctcaaaacttactgaacataagaaaattcattctggagagataccctac
aagtgtgaagaatgtggcaaagcttttaaacactcctcatcccttactacacataaaaga
attcatactggggagaaaccctacaaatgtgaagaatgtggcaaagcttttagccgatcc
tcaaaacttactgaacataagataattcatactggagagaaaccctataaatgtgagaga
tgtgacaaagcttttaaccaatctgcaaaccttactaaacataaaaaaatacatactgga
gagaaactacagaactggaatgtgtga

KEGG   Homo sapiens (human): 197320
Entry
197320            CDS       T01001                                 
Symbol
ZNF778
Name
(RefSeq) zinc finger protein 778
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    197320 (ZNF778)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    197320 (ZNF778)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    197320 (ZNF778)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 KRAB zf-C2H2_6 zf-C2H2_jaz Zn-ribbon_8 zinc_ribbon_15 zf-C2H2_11 zf_UBZ
Other DBs
NCBI-GeneID: 197320
NCBI-ProteinID: NP_872337
HGNC: 26479
Ensembl: ENSG00000170100
Pharos: Q96MU6(Tdark)
UniProt: Q96MU6
LinkDB
Position
16:89201970..89237141
AA seq 729 aa
MAAPDLAHGGHVSRDSVCLHEEQTQAAGMVAGWLINCYQDAVTFDDVAVDFTQEEWTLLD
PSQRDLYRDVMLENYENLASVEWRLKTKGPALRQDRSWFRASNETQTARSHNGGQLCDRT
QCGEAFSEHSGLSTHVRTQNTGDSCVSNHYERDFFIPCQKTLFKIGEQFSVLGQCGKAFS
STPNVVSQQACTRDRSLDYSSCGEVFLNQSYLQARAGSHNGEETWKWKPCGKALTHSMGC
ATPVEMHAVRNPHVCRECGKAFRYTAYLTGRVQVHPGEKPCELEECGKASPVSSSLTQHV
RIHAAEKPCECKECGKAFTGLSGLSKHVQTDPGQKPYECKDCGKACGGFYLLNEHGKTHT
REKPFACVVCGKYFRNSSCLNNHVRIHTGIKPYTCSYCGKAFTVRCGLTRHVRTHTGEKP
YTCKDCGKAFCTSSGLTEHVRTHTGEKPYECKDCGKSFTVSSSLTEHARIHTGEKPYECK
QCGKAFTGRSGLTKHMRTHTGEKPYECKDCGKAYNRVYLLNEHVKTHTEEKPFICTVCRK
SFRNSSCLNKHIQIHTGIKPYECKDCGKTFTVSSSLTEHIRTHTGEKPYECKVCGKAFTT
SSHLIVHIRTHTGEKPYICKECGKAFASSSHLIEHRRTHTGEKPYICNECGKAFRASSHL
HKHGRIHTGQKPYKCKECGKAYNRFYLLKEHLKTYTEEQVFVCKDCGKSFKNSSCLNHHT
QIHTDEKPF
NT seq 2190 nt   +upstreamnt  +downstreamnt
atggcagcccctgacctggcccacggaggtcatgtttctagggactcagtctgccttcat
gaagaacagacacaggcagcagggatggtggctggctggctgataaattgttaccaggac
gcggtgacctttgacgacgtggctgtggacttcacccaggaggaatggactttactggac
ccatctcagagagacctctacagagatgtgatgctggaaaactacgagaacctggcctca
gtagaatggcgacttaaaaccaaagggccagcacttcggcaggatagatcttggttcaga
gcatcaaatgagacacagacggcaagaagccacaatggagggcagctctgtgaccgcacg
cagtgtggagaagctttcagtgaacactcaggcctcagcacacacgtgagaactcaaaat
acaggagacagttgtgtgtctaatcattatgaaagggacttttttattccatgccagaaa
accttgttcaaaattggagagcagttttccgtgttgggtcagtgtggaaaagccttcagc
tctactccaaatgttgtttcccagcaagcatgcactcgggacagatctcttgactacagc
agctgtggggaagtgttccttaatcagtcataccttcaggcacgtgcgggaagtcacaac
ggagaagaaacatggaaatggaagccgtgtgggaaagctctaactcactccatgggctgc
gccacacctgttgaaatgcatgccgtcaggaatccccacgtatgtagggaatgtgggaag
gcctttaggtacactgcctaccttactggtcgcgtgcaagtccaccctggggaaaagccc
tgtgaattggaagaatgtggaaaagcctcccctgtttcttccagcctaactcaacatgta
agaattcatgctgcagagaaaccctgtgaatgtaaagaatgcggaaaagccttcactgga
ctctcaggtctttctaaacacgtccaaacagaccctggacagaagccctatgaatgtaag
gactgtgggaaagcctgcggtgggttttatctactgaatgagcatggaaaaactcacacg
agggagaagccctttgcatgtgtggtttgcggaaaatattttagaaattcctcatgcctt
aataatcatgttcgaattcacactggaataaaaccctatacatgcagctactgtgggaag
gccttcactgtgcgctgtggccttactagacacgtacgaacacacacgggcgagaagcca
tacacgtgtaaggactgcgggaaagccttctgtacatcctcgggccttactgagcatgta
aggactcacactggagagaaaccatatgaatgtaaagattgtgggaaatccttcactgtt
tcttcaagcctgactgagcacgcgagaatccataccggagagaaaccctacgaatgtaag
cagtgtggcaaagccttcacagggcgctcaggcctcactaaacacatgcggacacacacc
ggggagaagccctatgaatgtaaggactgtgggaaagcctacaatagggtttatctactg
aatgagcatgtgaaaactcacacagaggagaagccctttatatgtacggtatgcaggaaa
tccttcagaaattcctcgtgcctgaataagcacattcagattcacactggaataaaacct
tatgaatgtaaggactgtgggaaaacattcactgtttcttcgagcctaaccgagcacata
cgaactcacactggagagaaaccttatgaatgtaaagtatgcggaaaggccttcaccaca
tcctcacaccttatcgtgcacataagaacccacaccggtgagaaaccctacatatgtaag
gagtgtgggaaagcctttgcttcctcctcacaccttatcgaacacagaaggactcacaca
ggagagaaaccttacatatgtaacgagtgtgggaaagccttccgtgcctcctctcacctg
cataaacatggaagaattcacactgggcagaaaccctataaatgtaaggaatgtgggaaa
gcatacaataggttttatctactaaaagaacatttaaaaacttacactgaagagcaggtt
tttgtatgtaaggactgtggaaaatcttttaagaattcctcatgccttaaccatcacact
caaattcacactgatgagaaacctttctaa

KEGG   Homo sapiens (human): 199692
Entry
199692            CDS       T01001                                 
Symbol
ZNF627
Name
(RefSeq) zinc finger protein 627
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    199692 (ZNF627)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    199692 (ZNF627)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    199692 (ZNF627)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 KRAB zf-C2H2_6 Zn_ribbon_SprT Zn-ribbon_8 XPA_N DUF5830 zf-C2H2_11 HTH_18 zf-MYND zf-met zinc_ribbon_15
Other DBs
NCBI-GeneID: 199692
NCBI-ProteinID: NP_660338
OMIM: 612248
HGNC: 30570
Ensembl: ENSG00000198551
Pharos: Q7L945(Tdark)
UniProt: Q7L945
LinkDB
Position
19:11597483..11619161
AA seq 461 aa
MDSVAFEDVAVNFTLEEWALLDPSQKNLYRDVMRETFRNLASVGKQWEDQNIEDPFKIPR
RNISHIPERLCESKEGGQGEETFSQIPDGILNKKTPGVKPCESSVCGEVGMGPSSLNRHI
RDHTGREPNEYQEYGKKSYTRNQCGRALSYHRSFPVRERTHPGGKPYDCKECGETFISLV
SIRRHMLTHRGGVPYKCKVCGKAFDYPSLFRIHERSHTGEKPYECKQCGKAFSCSSYIRI
HERTHTGDKPYECKQCGKAFSCSKYIRIHERTHTGEKPYECKQCGKAFRCASSVRSHERT
HTGEKLFECKECGKALTCLASVRRHMIKHTGNGPYKCKVCGKAFDFPSSFRIHERTHTGE
KPYDCKQCGKAFSCSSSFRKHERIHTGEKPYKCTKCGKAFSRSSYFRIHERTHTGEKPYE
CKQCGKAFSRSTYFRVHEKIHTGEKPYENPNPNASVVPVLS
NT seq 1386 nt   +upstreamnt  +downstreamnt
atggattcagtggcctttgaggatgtggctgtgaacttcaccctggaggagtgggctttg
ctggatccttcccagaagaatctctacagggatgtgatgcgggaaaccttcaggaacctg
gcttctgtaggaaaacaatgggaagaccagaacattgaagacccattcaaaattcccagg
agaaatataagtcatattccagagagactctgtgaaagtaaagaaggtggtcaaggtgaa
gaaaccttcagccagattccagatggtattctgaacaagaaaactcctggagtaaaaccg
tgtgaaagcagtgtgtgtggagaagttggcatgggtccttcatcacttaataggcacatc
agagatcacactggacgtgaaccaaatgaatatcaggaatatggaaagaagtcatataca
cgtaaccagtgtggacgagccttgagttatcatcgctcttttccagtacgtgaaaggact
catcctggaggaaagccctatgattgtaaggaatgtggagaaacctttatttctcttgta
agcattcgaagacacatgttaacgcataggggaggtgtaccttacaaatgtaaggtgtgt
gggaaagcctttgattatcccagtttatttcgtatacatgaaagaagtcacactggagag
aaaccttatgaatgcaagcaatgtgggaaagccttcagttgttccagttacattagaata
catgaaaggactcacactggagataaaccctatgaatgcaagcagtgtgggaaagctttc
agttgttccaagtacattcgaatccatgaacgaactcacacaggagagaaaccctacgaa
tgtaaacagtgcggtaaagcctttaggtgcgccagttctgttcgaagtcacgagaggact
cacaccggagagaaactttttgaatgtaaggaatgcgggaaggctttgacttgtcttgca
agtgttagaagacacatgataaagcacactggcaatggaccttataaatgtaaggtgtgt
gggaaagcctttgatttccccagttcatttcgaatccatgaaaggacccacactggagag
aaaccctatgattgtaagcaatgtgggaaagccttcagttgttccagttcgtttcgaaaa
catgaaagaattcacactggagagaaaccctataaatgtacaaaatgtgggaaagccttc
agtcgttccagttacttccgaatccatgaaagaactcacactggagagaaaccctatgaa
tgtaagcaatgtgggaaagccttcagtcgatccacttactttcgagtacatgaaaaaatt
catactggagagaaaccctatgagaaccctaaccctaacgcttcagttgtcccagttctt
tcatga

KEGG   Homo sapiens (human): 199704
Entry
199704            CDS       T01001                                 
Symbol
ZNF585A, Zfp27
Name
(RefSeq) zinc finger protein 585A
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    199704 (ZNF585A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    199704 (ZNF585A)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    199704 (ZNF585A)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 KRAB Zn-ribbon_8 zf-C2H2_6 DZR Zn_ribbon_SprT zf-C2H2_jaz zinc_ribbon_15 C1_4 Zn_ribbon_recom HVO_2753_ZBP zf-met
Other DBs
NCBI-GeneID: 199704
NCBI-ProteinID: NP_001275729
HGNC: 26305
Ensembl: ENSG00000196967
Pharos: Q6P3V2(Tdark)
UniProt: Q6P3V2
LinkDB
Position
19:complement(37145540..37172695)
AA seq 769 aa
MPANWTSPQKSSALAPEDHGSSYEGSVSFRDVAIDFSREEWRHLDPSQRNLYRDVMLETY
SHLLSVGYQVPEAEVVMLEQGKEPWALQGERPRQSCPGEKLWDHNQCRKILSYKQVSSQP
QKMYPGEKAYECAKFEKIFTQKSQLKVHLKVLAGEKLYVCIECGKAFVQKPEFIIHQKTH
MREKPFKCNECGKSFFQVSSLFRHQRIHTGEKLYECSQCGKGFSYNSDLSIHEKIHTGER
HHECTDCGKAFTQKSTLKMHQKIHTGERSYICIECGQAFIQKTHLIAHRRIHTGEKPYEC
SNCGKSFISKSQLQVHQRVHTRVKPYICTEYGKVFSNNSNLVTHKKVQSREKSSICTECG
KAFTYRSELIIHQRIHTGEKPYECSDCGKAFTQKSALTVHQRIHTGEKSYICMKCGLAFI
QKAHLIAHQIIHTGEKPHKCGHCGKLFTSKSQLHVHKRIHTGEKPYMCNKCGKAFTNRSN
LITHQKTHTGEKSYICSKCGKAFTQRSDLITHQRIHTGEKPYECNTCGKAFTQKSHLNIH
QKIHTGERQYECHECGKAFNQKSILIVHQKIHTGEKPYVCTECGRAFIRKSNFITHQRIH
TGEKPYECSDCGKSFTSKSQLLVHQPVHTGEKPYVCAECGKAFSGRSNLSKHQKTHTGEK
PYICSECGKTFRQKSELITHHRIHTGEKPYECSDCGKSFTKKSQLQVHQRIHTGEKPYVC
AECGKAFTDRSNLNKHQTTHTGDKPYKCGICGKGFVQKSVFSVHQSSHA
NT seq 2310 nt   +upstreamnt  +downstreamnt
atgccagctaattggacctcacctcagaaatcctcagccctggctccagaggatcatggc
agctcctatgagggatcagtgtccttcagggatgtggctatcgatttcagcagagaggaa
tggcggcacctggacccttctcagagaaacctgtaccgggatgtgatgctggagacctac
agccacctgctctcagtaggatatcaagttcctgaagcagaggtggtcatgttggagcaa
ggaaaggaaccatgggcactgcagggtgagaggccacgtcagagctgcccaggagagaaa
ttatgggaccataatcaatgtagaaaaatcctcagttataaacaagtatcctctcaacct
caaaaaatgtatcctggggagaaagcttatgaatgcgccaaatttgaaaagatattcacc
cagaagtcacagctcaaagtacacctgaaagttcttgcaggagaaaagctctatgtatgc
attgaatgtgggaaggcttttgtacagaagccagaatttattatacaccagaaaacccat
atgagagagaaaccctttaaatgcaatgaatgtggaaaatccttttttcaagtgtcgtcc
ctcttcaggcatcagagaattcataccggagagaaactctatgaatgcagccagtgtggg
aaaggcttctcttataactcagatctcagtatacatgagaaaattcatactggagagaga
caccatgaatgcactgactgtggcaaagcattcacacaaaagtccacactcaagatgcat
cagaaaatccatacaggcgagagatcctacatctgtattgaatgcggacaggccttcatc
cagaagacccatttgattgcacaccgaagaattcatactggagaaaaaccatatgagtgc
agtaactgtggcaaatccttcatttccaagtcacaacttcaggtacatcaacgtgttcac
acaagagtgaagccctatatatgtaccgaatatgggaaggtcttcagcaataattccaac
ctcgttacacataagaaagttcaaagtagagagaaatcttccatatgtactgagtgtggg
aaggcctttacctacaggtcagagttgattattcatcagagaattcacactggagagaaa
ccttatgaatgcagtgactgtgggaaagccttcactcagaagtcagcactcacagtgcat
cagagaattcatacaggagaaaaatcgtatatatgcatgaaatgtggactggccttcatt
cagaaggcacacttgattgcacatcaaataattcatactggagagaaacctcataaatgt
ggtcactgtgggaaattgtttacctccaagtcgcaactccatgttcataaacgaattcac
acaggagaaaagccctatatgtgcaataaatgtgggaaggcattcaccaaccggtcaaat
ctcattacacatcagaaaactcatacaggagagaaatcttatatatgttccaaatgtgga
aaggccttcacccagaggtcagacttgattacacatcagagaatccatactggggagaag
ccttatgaatgcaatacttgtggaaaagccttcactcagaagtcacacctcaatatacat
cagaaaattcacactggagagagacagtatgaatgccacgaatgtgggaaagccttcaac
cagaaatcaatactcattgttcatcagaaaattcatacaggagagaaaccctatgtatgc
actgagtgtggaagagctttcatccgcaagtcaaactttattactcatcaaagaattcat
actggagagaagccttatgaatgcagtgactgtgggaagtcctttacctccaagtctcag
ctcctggtgcatcagccagttcacacaggagagaaaccctatgtgtgtgccgagtgcggg
aaggcctttagtggcaggtcaaatctcagtaagcaccagaaaactcataccggagaaaag
ccctacatttgttctgaatgtgggaagacctttcgacagaagtcagagttgattacacat
cacagaattcatactggagagaaaccttatgagtgcagtgactgtgggaagtctttcact
aaaaaatcacagctccaagtgcatcagcgaattcacactggagagaagccttacgtgtgt
gctgagtgtgggaaggcctttactgacaggtccaatttgaataaacatcagacaacacac
actggagacaaaccctacaagtgtggcatctgtgggaaaggcttcgttcagaaatcagtg
ttcagcgtccatcagagcagccacgcttga

KEGG   Homo sapiens (human): 201514
Entry
201514            CDS       T01001                                 
Symbol
ZNF584
Name
(RefSeq) zinc finger protein 584
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    201514 (ZNF584)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    201514 (ZNF584)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    201514 (ZNF584)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 KRAB zf-C2H2_6 Zn-ribbon_8 zf-C2H2_jaz zf_UBZ C1_1 zinc_ribbon_15 HVO_2753_ZBP zf-met zf-LYAR HypA zf-C2H2_11 zf-Di19 LIM
Other DBs
NCBI-GeneID: 201514
NCBI-ProteinID: NP_775819
HGNC: 27318
Ensembl: ENSG00000171574
Pharos: Q8IVC4(Tdark)
UniProt: Q8IVC4
LinkDB
Position
19:58401558..58418327
AA seq 421 aa
MAGEAEAQLDPSLQGLVMFEDVTVYFSREEWGLLNVTQKGLYRDVMLENFALVSSLGLAP
SRSPVFTQLEDDEQSWVPSWVDVTPVSRAEARRGFGLDGLCRVEDERAHPEHLKSYRVIQ
HQDTHSEGKPRRHTEHGAAFPPGSSCGQQQEVHVAEKLFKCSDCGKVFLKAFALLDHLIT
HSEERPFRCPTGRSAFKKSAHINPRKIHTGETAHVCNECGKAFSYPSKLRKHQKVHTGIK
PFKCSDCGKTFNRKDALVLHQRIHTGERPYECSKCGKTFSVLSTLIRHRKVHIGERPYEC
TECGKFFKYNNSFILHQRVHTGERPFECKQCGKGYVTRSGLYQHWKVHTGERPYECSLCG
KTFTTRSYRNRHQQFHTEERSYECTECGKAFKHSSTLLQHKKVHTPERRQEDRAHGKVVS
C
NT seq 1266 nt   +upstreamnt  +downstreamnt
atggccggggaggcggaggctcagttggacccatcattgcagggcttggtgatgtttgag
gatgtgacggtatatttctccagggaggagtgggggctccttaatgtgacccagaagggc
ctataccgggatgtgatgctggagaactttgcactcgttagctcactgggacttgcacct
tcgagatcccctgtgtttacccagctggaggatgatgaacagtcgtgggtgcccagctgg
gtggatgtgactccagtcagcagagcagaagccaggagaggttttggtcttgatggtttg
tgtagagtggaggatgagagagcccatcctgagcatctaaagagctacagagtcatccag
caccaggacactcatagtgaggggaaaccaagaaggcacactgagcatggggcagctttc
ccacctggttccagttgtgggcaacagcaagaagtccatgtggcagagaagctgttcaaa
tgcagtgactgtgggaaggtgttcttaaaggcctttgccctccttgaccatctgataacg
cattctgaagagagacccttcagatgcccaacaggcagaagtgctttcaagaagtcagct
catattaacccccgaaaaattcacactggagaaacagcccatgtgtgtaatgaatgtggg
aaggccttcagttacccgtctaagctgaggaaacaccagaaggttcacacaggcataaaa
ccttttaagtgtagtgactgtggtaaaaccttcaaccgcaaagacgcacttgttctacac
cagaggattcacactggagaaaggccttacgagtgcagcaaatgtggtaaaaccttcagt
gttctgtctaccctcattcggcaccggaaagtgcacattggagaaaggccctatgagtgt
acagaatgtgggaagttctttaaatacaataatagcttcattcttcaccagagagttcac
actggagaaaggccttttgaatgcaagcaatgtgggaaaggctacgtgacccgttcaggc
ctctatcagcactggaaagtccacactggggaacggccctatgaatgtagcctgtgtggg
aaaaccttcactaccagatcctaccgcaatcggcaccagcagttccacactgaagagagg
tcttatgaatgtacagagtgtgggaaggccttcaaacatagttccaccctccttcagcac
aagaaagtccatactccagaaaggcgtcaggaggacagggcacatgggaaggtcgttagc
tgctag

KEGG   Homo sapiens (human): 219749
Entry
219749            CDS       T01001                                 
Symbol
ZNF25, KOX19, Zfp9
Name
(RefSeq) zinc finger protein 25
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    219749 (ZNF25)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    219749 (ZNF25)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    219749 (ZNF25)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 KRAB zf-C2H2_6 Zn-ribbon_8 zinc_ribbon_15 zf_UBZ C1_4 zf-C2H2_jaz Zn_ribbon_SprT