KEGG   Homo sapiens (human): 100132285
Entry
100132285         CDS       T01001                                 
Symbol
KIR2DS2, 183ActI, CD158J, CD158b, KIR-2DS2, KIR2DL1, NKAT-5, NKAT5, cl-49
Name
(RefSeq) killer cell immunoglobulin like receptor, two Ig domains and short cytoplasmic tail 2
  KO
K07982  killer cell immunoglobulin-like receptor 2DS
Organism
hsa  Homo sapiens (human)
Pathway
hsa04612  Antigen processing and presentation
hsa04650  Natural killer cell mediated cytotoxicity
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100132285 (KIR2DS2)
   04612 Antigen processing and presentation
    100132285 (KIR2DS2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    100132285 (KIR2DS2)
CD molecules [BR:hsa04090]
 Proteins
  100132285 (KIR2DS2)
SSDB
Motif
Pfam: ig Ig_3 Ig_2
Other DBs
NCBI-GeneID: 100132285
NCBI-ProteinID: NP_036444
OMIM: 604953
HGNC: 6334
Pharos: P43631(Tdark)
UniProt: P43631 K7R1S5
Structure
LinkDB
Position
19q13.4
AA seq 304 aa
MSLMVVSMACVGFFLLQGAWPHEGVHRKPSLLAHPGPLVKSEETVILQCWSDVRFEHFLL
HREGKYKDTLHLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDI
VITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHERRFSAGPKVNGT
FQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVTGNPSNSWPSPTEPSSKTGN
PRHLHVLIGTSVVKIPFTILLFFLLHRWCSNKKNAAVMDQEPAGNRTVNSEDSDEQDHQE
VSYA
NT seq 915 nt   +upstreamnt  +downstreamnt
atgtcgctcatggtcgtcagcatggcgtgtgttgggttcttcttgctgcagggggcctgg
ccacatgagggagtccacagaaaaccttccctcctggcccacccaggtcccctggtgaaa
tcagaagagacagtcatcctgcaatgttggtcagatgtcaggtttgagcacttccttctg
cacagagaggggaagtataaggacactttgcacctcattggagagcaccatgatggggtc
tccaaggccaacttctccatcggtcccatgatgcaagaccttgcagggacctacagatgc
tacggttctgttactcactccccctatcagttgtcagctcccagtgaccctctggacatc
gtcatcacaggtctatatgagaaaccttctctctcagcccagccgggccccacggttttg
gcaggagagagcgtgaccttgtcctgcagctcccggagctcctatgacatgtaccatcta
tccagggagggggaggcccatgaacgtaggttctctgcagggcccaaggtcaacggaaca
ttccaggccgactttcctctgggccctgccacccacggaggaacctacagatgcttcggc
tctttccgtgactctccctatgagtggtcaaactcgagtgacccactgcttgtttctgtc
acaggaaacccttcaaatagttggccttcacccactgaaccaagctccaaaaccggtaac
cccagacacctgcatgttctgattgggacctcagtggtcaaaatccctttcaccatcctc
ctcttctttctccttcatcgctggtgctccaacaaaaaaaatgctgctgtaatggaccaa
gagcctgcagggaacagaacagtgaacagcgaggattctgatgaacaagaccatcaggag
gtgtcatacgcataa

KEGG   Homo sapiens (human): 115653
Entry
115653            CDS       T01001                                 
Symbol
KIR3DL3, CD158Z, KIR3DL7, KIR44, KIRC1
Name
(RefSeq) killer cell immunoglobulin like receptor, three Ig domains and long cytoplasmic tail 3
  KO
K07980  killer cell immunoglobulin-like receptor 3DL
Organism
hsa  Homo sapiens (human)
Pathway
hsa04612  Antigen processing and presentation
hsa04650  Natural killer cell mediated cytotoxicity
hsa05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    115653 (KIR3DL3)
   04612 Antigen processing and presentation
    115653 (KIR3DL3)
 09160 Human Diseases
  09163 Immune disease
   05332 Graft-versus-host disease
    115653 (KIR3DL3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    115653 (KIR3DL3)
CD molecules [BR:hsa04090]
 Proteins
  115653 (KIR3DL3)
SSDB
Motif
Pfam: ig Ig_3 Ig_2
Other DBs
NCBI-GeneID: 115653
NCBI-ProteinID: NP_703144
OMIM: 610095
HGNC: 16312
Ensembl: ENSG00000242019
UniProt: Q8N743
LinkDB
Position
19:54724442..54736632
AA seq 410 aa
MSLMVVSMACVGFFLLEGPWPHVGGQDKPFLSAWPGTVVSEGQHVTLQCRSRLGFNEFSL
SKEDGMPVPELYNRIFRNSFLMGPVTPAHAGTYRCCSSHPHSPTGWSAPSNPVVIMVTGV
HRKPSLLAHPGPLVKSGETVILQCWSDVRFERFLLHREGITEDPLRLVGQLHDAGSQVNY
SMGPMTPALAGTYRCFGSVTHLPYELSAPSDPLDIVVVGLYGKPSLSAQPGPTVQAGENV
TLSCSSRSLFDIYHLSREAEAGELRLTAVLRVNGTFQANFPLGPVTHGGNYRCFGSFRAL
PHAWSDPSDPLPVSVTGNSRNLHVLIGTSVVIIPFAILLFFLLHRWCANKKNAVVMDQEP
AGNRTVNREDSDEQDPQEVTYAQLNHCVFTQRKITRPSQRPKTPPTDTSV
NT seq 1233 nt   +upstreamnt  +downstreamnt
atgtcgctcatggtcgtcagcatggcgtgtgttgggttcttcttgctggaggggccctgg
ccacatgtgggtggtcaggacaagcccttcctctctgcctggcccggcactgtggtgtct
gaaggacaacatgtgactcttcagtgtcgctctcgtcttgggtttaatgaattcagtctg
tccaaagaagacgggatgcctgtccctgagctctacaacagaatattccggaacagcttt
ctcatgggccctgtgaccccagcacatgcagggacctacagatgttgcagttcacaccca
cactcccccactgggtggtcggcacccagcaaccctgtggtgatcatggtcacaggagtc
cacagaaaaccttccctcctggcccacccaggtcccctggtgaaatcaggagagacggtc
atcctgcaatgttggtcagatgtcaggtttgagcgcttccttctgcacagagaggggatc
actgaggaccccttgcgcctcgttggacagctccacgatgcgggttcccaggtcaactat
tccatgggtcccatgacacctgcccttgcagggacctacagatgctttggttctgtcact
cacttaccctatgagttgtcggctcccagtgaccctctggacatcgtggtcgtaggtcta
tatgggaaaccttctctctcagcccagccgggccccacggttcaggcaggagagaatgtg
accttgtcctgcagctcccggagcttgtttgacatttaccatctatccagggaggcggag
gccggtgaacttaggctcactgcagtgctgagggtcaatggaacattccaggccaacttc
cctctgggccctgtgacccacggagggaactacagatgcttcggctctttccgtgccctg
ccccatgcgtggtcagacccgagtgacccactgcccgtttctgtcacaggtaactccaga
aacctgcacgttctgattgggacctcagtggtcatcatcccctttgctatcctcctcttc
tttctccttcatcgctggtgtgccaacaaaaagaatgctgttgtaatggaccaagagcct
gcagggaacagaacagtgaacagggaggactctgatgaacaagaccctcaggaggtgaca
tacgcacagttgaatcactgcgttttcacacagagaaaaatcactcgcccttctcagagg
cccaagacacccccaacagataccagcgtgtaa

KEGG   Homo sapiens (human): 3802
Entry
3802              CDS       T01001                                 
Symbol
KIR2DL1, CD158A, KIR-K64, KIR221, KIR2DL3, NKAT, NKAT-1, NKAT1, p58.1
Name
(RefSeq) killer cell immunoglobulin like receptor, two Ig domains and long cytoplasmic tail 1
  KO
K07981  killer cell immunoglobulin-like receptor 2DL1/2/3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04612  Antigen processing and presentation
hsa04650  Natural killer cell mediated cytotoxicity
hsa05332  Graft-versus-host disease
Drug target
Lirilumab: D10444
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    3802 (KIR2DL1)
   04612 Antigen processing and presentation
    3802 (KIR2DL1)
 09160 Human Diseases
  09163 Immune disease
   05332 Graft-versus-host disease
    3802 (KIR2DL1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    3802 (KIR2DL1)
CD molecules [BR:hsa04090]
 Proteins
  3802 (KIR2DL1)
SSDB
Motif
Pfam: ig Ig_2 Ig_3
Other DBs
NCBI-GeneID: 3802
NCBI-ProteinID: NP_055033
OMIM: 604936
HGNC: 6329
Ensembl: ENSG00000125498
Pharos: P43626(Tbio)
UniProt: P43626 Q6H2H2 Q6H2H3
Structure
LinkDB
Position
19:54769793..54784322
AA seq 348 aa
MSLLVVSMACVGFFLLQGAWPHEGVHRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLL
HREGMFNDTLRLIGEHHDGVSKANFSISRMTQDLAGTYRCYGSVTHSPYQVSAPSDPLDI
VIIGLYEKPSLSAQLGPTVLAGENVTLSCSSRSSYDMYHLSREGEAHERRLPAGPKVNGT
FQADFPLGPATHGGTYRCFGSFHDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSKTGN
PRHLHILIGTSVVIILFILLFFLLHRWCSNKKNAAVMDQESAGNRTANSEDSDEQDPQEV
TYTQLNHCVFTQRKITRPSQRPKTPPTDIIVYTELPNAESRSKVVSCP
NT seq 1047 nt   +upstreamnt  +downstreamnt
atgtcgctcttggtcgtcagcatggcgtgtgttgggttcttcttgctgcagggggcctgg
ccacatgagggagtccacagaaaaccttccctcctggcccacccaggtcgcctggtgaaa
tcagaagagacagtcatcctgcagtgttggtcagatgtcatgtttgaacacttccttctg
cacagagaggggatgtttaacgacactttgcgcctcattggagaacaccatgatggggtc
tccaaggccaacttctccatcagtcgcatgacgcaagacctggcagggacctacagatgc
tacggttctgttactcactccccctatcaggtgtcagctcccagtgaccctctggacatc
gtgatcataggtctatatgagaaaccttctctctcagcccagctgggccccacggttctg
gcaggagagaatgtgaccttgtcctgcagctcccggagctcctatgacatgtaccatcta
tccagggaaggggaggcccatgaacgtaggctccctgcagggcccaaggtcaacggaaca
ttccaggctgactttcctctgggccctgccacccacggagggacctacagatgcttcggc
tctttccatgactctccatacgagtggtcaaagtcaagtgacccactgcttgtttctgtc
acaggaaacccttcaaatagttggccttcacccactgaaccaagctccaaaaccggtaac
ccccgacacctgcacattctgattgggacctcagtggtcatcatcctcttcatcctcctc
ttctttctccttcatcgctggtgctccaacaaaaaaaatgctgcggtaatggaccaagag
tctgcaggaaacagaacagcgaatagcgaggactctgatgaacaagaccctcaggaggtg
acatacacacagttgaatcactgcgttttcacacagagaaaaatcactcgcccttctcag
aggcccaagacacccccaacagatatcatcgtgtacacggaacttccaaatgctgagtcc
agatccaaagttgtctcctgcccatga

KEGG   Homo sapiens (human): 3803
Entry
3803              CDS       T01001                                 
Symbol
KIR2DL2, CD158B1, CD158b, NKAT-6, NKAT6, p58.2
Name
(RefSeq) killer cell immunoglobulin like receptor, two Ig domains and long cytoplasmic tail 2
  KO
K07981  killer cell immunoglobulin-like receptor 2DL1/2/3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04612  Antigen processing and presentation
hsa04650  Natural killer cell mediated cytotoxicity
hsa05332  Graft-versus-host disease
Drug target
Lirilumab: D10444
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    3803 (KIR2DL2)
   04612 Antigen processing and presentation
    3803 (KIR2DL2)
 09160 Human Diseases
  09163 Immune disease
   05332 Graft-versus-host disease
    3803 (KIR2DL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    3803 (KIR2DL2)
CD molecules [BR:hsa04090]
 Proteins
  3803 (KIR2DL2)
SSDB
Motif
Pfam: ig Ig_3 Ig_2
Other DBs
NCBI-GeneID: 3803
NCBI-ProteinID: NP_055034
OMIM: 604937
HGNC: 6330
Pharos: P43627(Tdark)
UniProt: P43627 Q6H2H0 Q8N742
Structure
LinkDB
Position
19q13.4
AA seq 348 aa
MSLMVVSMACVGFFLLQGAWPHEGVHRKPSLLAHPGRLVKSEETVILQCWSDVRFEHFLL
HREGKFKDTLHLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDI
VITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHECRFSAGPKVNGT
FQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVTGNPSNSWPSPTEPSSKTGN
PRHLHILIGTSVVIILFILLFFLLHRWCSNKKNAAVMDQESAGNRTANSEDSDEQDPQEV
TYTQLNHCVFTQRKITRPSQRPKTPPTDIIVYTELPNAESRSKVVSCP
NT seq 1047 nt   +upstreamnt  +downstreamnt
atgtcgctcatggtcgtcagcatggcgtgtgttgggttcttcttgctgcagggggcctgg
ccacatgagggagtccacagaaaaccttccctcctggcccacccaggtcgcctggtgaaa
tcagaagagacagtcatcctgcaatgttggtcagatgtcaggtttgagcacttccttctg
cacagagaagggaagtttaaggacactttgcacctcattggagagcaccatgatggggtc
tccaaagccaacttctccatcggtcccatgatgcaagaccttgcagggacctacagatgc
tacggttctgttactcactccccctatcagttgtcagctcccagtgaccctctggacatc
gtcatcacaggtctatatgagaaaccttctctctcagcccagccgggccccacggttctg
gcaggagagagcgtgaccttgtcctgcagctcccggagctcctatgacatgtaccatcta
tccagggagggggaggcccatgaatgtaggttctctgcagggcccaaggtcaacggaaca
ttccaggccgactttcctctgggccctgccacccacggaggaacctacagatgcttcggc
tctttccgtgactctccatacgagtggtcaaactcgagtgacccactgcttgtttctgtc
acaggaaacccttcaaatagttggccttcacccactgaaccaagctctaaaaccggtaac
ccccgacacctgcacattctgattgggacctcagtggtcatcatcctcttcatcctcctc
ttctttctccttcatcgctggtgctccaacaaaaaaaatgctgcggtaatggaccaagag
tctgcagggaacagaacagcgaatagcgaggactctgatgaacaagaccctcaggaggtg
acatacacacagttgaatcactgcgttttcacacagagaaaaatcactcgcccttctcag
aggcccaagacacccccaacagatatcatcgtgtacacggaacttccaaatgctgagtcc
agatccaaagttgtctcctgcccatga

KEGG   Homo sapiens (human): 3804
Entry
3804              CDS       T01001                                 
Symbol
KIR2DL3, CD158B2, CD158b, GL183, KIR-023GB, KIR-K7b, KIR-K7c, KIR2DL, KIR2DS5, KIRCL23, NKAT, NKAT2, NKAT2A, NKAT2B, p58
Name
(RefSeq) killer cell immunoglobulin like receptor, two Ig domains and long cytoplasmic tail 3
  KO
K07981  killer cell immunoglobulin-like receptor 2DL1/2/3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04612  Antigen processing and presentation
hsa04650  Natural killer cell mediated cytotoxicity
hsa05332  Graft-versus-host disease
Drug target
Lirilumab: D10444
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    3804 (KIR2DL3)
   04612 Antigen processing and presentation
    3804 (KIR2DL3)
 09160 Human Diseases
  09163 Immune disease
   05332 Graft-versus-host disease
    3804 (KIR2DL3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    3804 (KIR2DL3)
CD molecules [BR:hsa04090]
 Proteins
  3804 (KIR2DL3)
SSDB
Motif
Pfam: ig Ig_3 Ig_2 Shisa
Other DBs
NCBI-GeneID: 3804
NCBI-ProteinID: NP_056952
OMIM: 604938
HGNC: 6331
Ensembl: ENSG00000243772
Pharos: P43628(Tbio)
UniProt: P43628 E3NZD8
Structure
LinkDB
Position
19:54738513..54753052
AA seq 341 aa
MSLMVVSMVCVGFFLLQGAWPHEGVHRKPSLLAHPGPLVKSEETVILQCWSDVRFQHFLL
HREGKFKDTLHLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDI
VITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHERRFSAGPKVNGT
FQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVTGNPSNSWPSPTEPSSETGN
PRHLHVLIGTSVVIILFILLLFFLLHRWCCNKKNAVVMDQEPAGNRTVNREDSDEQDPQE
VTYAQLNHCVFTQRKITRPSQRPKTPPTDIIVYTELPNAEP
NT seq 1026 nt   +upstreamnt  +downstreamnt
atgtcgctcatggtcgtcagcatggtgtgtgttgggttcttcttgctgcagggggcctgg
ccacatgagggagtccacagaaaaccttccctcctggcccacccaggtcccctggtgaaa
tcagaagagacagtcatcctgcaatgttggtcagatgtcaggtttcagcacttccttctg
cacagagaagggaagtttaaggacactttgcacctcattggagagcaccatgatggggtc
tccaaggccaacttctccatcggtcccatgatgcaagaccttgcagggacctacagatgc
tacggttctgttactcactccccctatcagttgtcagctcccagtgaccctctggacatc
gtcatcacaggtctatatgagaaaccttctctctcagcccagccgggccccacggttctg
gcaggagagagcgtgaccttgtcctgcagctcccggagctcctatgacatgtaccatcta
tccagggagggggaggcccatgaacgtaggttctctgcagggcccaaggtcaacggaaca
ttccaggccgactttcctctgggccctgccacccacggaggaacctacagatgcttcggc
tctttccgtgactctccatacgagtggtcaaactcgagtgacccactgcttgtttctgtc
acaggaaacccttcaaatagttggccttcacccactgaaccaagctccgaaaccggtaac
cccagacacctgcatgttctgattgggacctcagtggtcatcatcctcttcatcctcctc
ctcttctttctccttcatcgctggtgctgcaacaaaaaaaatgctgttgtaatggaccaa
gagcctgcagggaacagaacagtgaacagggaggactctgatgaacaagaccctcaggag
gtgacatatgcacagttgaatcactgcgttttcacacagagaaaaatcactcgcccttct
cagaggcccaagacacccccaacagatatcatcgtgtacacggaacttccaaatgctgag
ccctga

KEGG   Homo sapiens (human): 3805
Entry
3805              CDS       T01001                                 
Symbol
KIR2DL4, CD158D, G9P, KIR-103AS, KIR-2DL4, KIR103, KIR103AS
Name
(RefSeq) killer cell immunoglobulin like receptor, two Ig domains and long cytoplasmic tail 4
  KO
K24231  killer cell immunoglobulin-like receptor 2DL4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04218  Cellular senescence
hsa04612  Antigen processing and presentation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    3805 (KIR2DL4)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    3805 (KIR2DL4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    3805 (KIR2DL4)
CD molecules [BR:hsa04090]
 Proteins
  3805 (KIR2DL4)
SSDB
Motif
Pfam: ig Ig_2 Ig_3 V-set
Other DBs
NCBI-GeneID: 3805
NCBI-ProteinID: NP_002246
OMIM: 604945
HGNC: 6332
Ensembl: ENSG00000189013
Pharos: Q99706(Tbio)
UniProt: Q99706
Structure
LinkDB
Position
19:54803610..54814517
AA seq 377 aa
MSMSPTVIILACLGFFLDQSVWAHVGGQDKPFCSAWPSAVVPQGGHVTLRCHYRRGFNIF
TLYKKDGVPVPELYNRIFWNSFLISPVTPAHAGTYRCRGFHPHSPTEWSAPSNPLVIMVT
GLYEKPSLTARPGPTVRAGENVTLSCSSQSSFDIYHLSREGEAHELRLPAVPSINGTFQA
DFPLGPATHGETYRCFGSFHGSPYEWSDPSDPLPVSVTGNPSSSWPSPTEPSFKTGIARH
LHAVIRYSVAIILFTILPFFLLHRWCSKKKNAAVMNQEPAGHRTVNREDSDEQDPQEVTY
AQLDHCIFTQRKITGPSQRSKRPSTDTSVCIELPNAEPRALSPAHEHHSQALMGSSRETT
ALSQTQLASSNVPAAGI
NT seq 1134 nt   +upstreamnt  +downstreamnt
atgtccatgtcacccacggtcatcatcctggcatgtcttgggttcttcttggaccagagt
gtgtgggcacacgtgggtggtcaggacaagcccttctgctctgcctggcccagcgctgtg
gtgcctcaaggaggacacgtgactcttcggtgtcactatcgtcgtgggtttaacatcttc
acgctgtacaagaaagatggggtccctgtccctgagctctacaacagaatattctggaac
agtttcctcattagccctgtgaccccagcacacgcagggacctacagatgtcgaggtttt
cacccgcactcccccactgagtggtcggcacccagcaaccccctggtgatcatggtcaca
ggtctatatgagaaaccttcgcttacagcccggccgggccccacggttcgcgcaggagag
aacgtgaccttgtcctgcagctcccagagctcctttgacatctaccatctatccagggag
ggggaagcccatgaacttaggctccctgcagtgcccagcatcaatggaacattccaggcc
gacttccctctgggtcctgccacccacggagagacctacagatgcttcggctctttccat
ggatctccctacgagtggtcagacccgagtgacccactgcctgtttctgtcacaggaaac
ccttctagtagttggccttcacccactgaaccaagcttcaaaactggtatcgccagacac
ctgcatgctgtgattaggtactcagtggccatcatcctctttaccatccttcccttcttt
ctccttcatcgctggtgctccaaaaaaaaaaatgctgctgtaatgaaccaagagcctgcg
ggacacagaacagtgaacagggaggactctgatgaacaagaccctcaggaggtgacatac
gcacagttggatcactgcattttcacacagagaaaaatcactggcccttctcagaggagc
aagagaccctcaacagataccagcgtgtgtatagaacttccaaatgctgagcccagagcg
ttgtctcctgcccatgagcaccacagtcaggccttgatgggatcttctagggagacaaca
gccctgtctcaaacccagcttgccagctctaatgtaccagcagctggaatctga

KEGG   Homo sapiens (human): 3806
Entry
3806              CDS       T01001                                 
Symbol
KIR2DS1, CD158H, CD158a, p50.1
Name
(RefSeq) killer cell immunoglobulin like receptor, two Ig domains and short cytoplasmic tail 1
  KO
K07982  killer cell immunoglobulin-like receptor 2DS
Organism
hsa  Homo sapiens (human)
Pathway
hsa04612  Antigen processing and presentation
hsa04650  Natural killer cell mediated cytotoxicity
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    3806 (KIR2DS1)
   04612 Antigen processing and presentation
    3806 (KIR2DS1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    3806 (KIR2DS1)
CD molecules [BR:hsa04090]
 Proteins
  3806 (KIR2DS1)
SSDB
Motif
Pfam: ig Ig_3 Ig_2
Other DBs
NCBI-GeneID: 3806
NCBI-ProteinID: NP_055327
OMIM: 604952
HGNC: 6333
Pharos: Q14954(Tdark)
UniProt: Q14954 A0A7D4Y6C7
LinkDB
Position
19q13.4
AA seq 304 aa
MSLTVVSMACVGFFLLQGAWPHEGVHRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLL
HREGMFNDTLRLIGEHHDGVSKANFSISRMKQDLAGTYRCYGSVTHSPYQLSAPSDPLDI
VIIGLYEKPSLSAQPGPTVLAGENVTLSCSSRSSYDMYHLSREGEAHERRLPAGTKVNGT
FQANFPLGPATHGGTYRCFGSFRDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSETGN
PRHLHVLIGTSVVKIPFTILLFFLLHRWCSDKKNAAVMDQEPAGNRTVNSEDSDEQDHQE
VSYA
NT seq 915 nt   +upstreamnt  +downstreamnt
atgtcgctcacggtcgtcagcatggcgtgtgttgggttcttcttgctgcagggggcctgg
ccacatgagggagtccacagaaaaccttccctcctggcccacccaggtcgcctggtgaaa
tcagaagagacagtcatcctgcaatgttggtcagatgtcatgtttgaacacttccttctg
cacagagaggggatgtttaacgacactttgcgcctcattggagaacaccatgatggggtc
tccaaggccaacttctccatcagtcgcatgaagcaagacctggcagggacctacagatgc
tacggttctgttactcactccccctatcagttgtcagctcccagtgaccctctggacatc
gtgatcataggtctatatgagaaaccttctctctcagcccagccgggccccacggttctg
gcaggagagaatgtgaccttgtcctgcagctcccggagctcctatgacatgtaccatcta
tccagggaaggggaggcccatgaacgtaggctccctgcagggaccaaggtcaacggaaca
ttccaggccaactttcctctgggccctgccacccatggagggacctacagatgcttcggc
tctttccgtgactctccatacgagtggtcaaagtcaagtgacccactgcttgtttctgtc
acaggaaacccttcaaatagttggccttcacccactgaaccaagctccgaaaccggtaac
cccagacacctacatgttctgattgggacctcagtggtcaaaatccctttcaccatcctc
ctcttctttctccttcatcgctggtgctccgacaaaaaaaatgctgctgtaatggaccaa
gagcctgcagggaacagaacagtgaacagcgaggattctgatgaacaagaccatcaggag
gtgtcatacgcataa

KEGG   Homo sapiens (human): 3808
Entry
3808              CDS       T01001                                 
Symbol
KIR2DS3, NKAT7
Name
(RefSeq) killer cell immunoglobulin like receptor, two Ig domains and short cytoplasmic tail 3
  KO
K07982  killer cell immunoglobulin-like receptor 2DS
Organism
hsa  Homo sapiens (human)
Pathway
hsa04612  Antigen processing and presentation
hsa04650  Natural killer cell mediated cytotoxicity
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    3808 (KIR2DS3)
   04612 Antigen processing and presentation
    3808 (KIR2DS3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    3808 (KIR2DS3)
CD molecules [BR:hsa04090]
 Proteins
  3808 (KIR2DS3)
SSDB
Motif
Pfam: ig Ig_2 Ig_3
Other DBs
NCBI-GeneID: 3808
NCBI-ProteinID: NP_036445
OMIM: 604954
HGNC: 6335
Pharos: Q14952(Tdark)
UniProt: Q14952 K7QT50
LinkDB
Position
19q13.4
AA seq 304 aa
MSLMVISMACVGFFWLQGAWPHEGFRRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLL
HREGTFNDTLRLIGEHIDGVSKANFSIGRMRQDLAGTYRCYGSVPHSPYQFSAPSDPLDI
VITGLYEKPSLSAQPGPTVLAGESVTLSCSSWSSYDMYHLSTEGEAHERRFSAGPKVNGT
FQADFPLGPATQGGTYRCFGSFHDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSKTGN
PRHLHVLIGTSVVKLPFTILLFFLLHRWCSDKKNASVMDQGPAGNRTVNREDSDEQDHQE
VSYA
NT seq 915 nt   +upstreamnt  +downstreamnt
atgtcgctcatggtcatcagcatggcatgtgttgggttcttctggctgcagggggcctgg
ccacatgagggattccgcagaaaaccttccctcctggcccacccaggtcgcctggtgaaa
tcagaagagacagtcatcctgcaatgttggtcagatgtcatgtttgagcacttccttctg
cacagagaggggacgtttaacgacactttgcgcctcattggagagcacattgatggggtc
tccaaggccaacttctccatcggtcgcatgaggcaagacctggcagggacctacagatgc
tacggttctgttcctcactccccctatcagttttcagctcccagtgaccctctggacatc
gtgatcacaggtctatatgagaaaccttctctctcagcccagccgggccccacggttctg
gcaggagagagcgtgaccttgtcctgcagctcctggagctcctatgacatgtaccatcta
tccacggagggggaggcccatgaacgtaggttctctgcagggcccaaggtcaacggaaca
ttccaggccgactttcctctgggccctgccacccaaggaggaacctacagatgcttcggc
tctttccatgactctccctacgagtggtcaaagtcaagtgacccactgcttgtttctgtc
acaggaaacccttcaaatagttggccttcacccactgaaccaagctccaaaaccggtaac
cccagacacctacacgttctgattgggacctcagtggtcaaactccctttcaccatcctc
ctcttctttctccttcatcgctggtgctccgacaaaaaaaatgcatctgtaatggaccaa
gggcctgcggggaacagaacagtgaacagggaggattctgacgaacaggaccatcaggag
gtgtcatacgcataa

KEGG   Homo sapiens (human): 3809
Entry
3809              CDS       T01001                                 
Symbol
KIR2DS4, CD158I, KIR-2DS4, KIR1D, KIR412, KKA3, NKAT-8, NKAT8
Name
(RefSeq) killer cell immunoglobulin like receptor, two Ig domains and short cytoplasmic tail 4
  KO
K07982  killer cell immunoglobulin-like receptor 2DS
Organism
hsa  Homo sapiens (human)
Pathway
hsa04612  Antigen processing and presentation
hsa04650  Natural killer cell mediated cytotoxicity
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    3809 (KIR2DS4)
   04612 Antigen processing and presentation
    3809 (KIR2DS4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    3809 (KIR2DS4)
CD molecules [BR:hsa04090]
 Proteins
  3809 (KIR2DS4)
SSDB
Motif
Pfam: ig Ig_3 Ig_2
Other DBs
NCBI-GeneID: 3809
NCBI-ProteinID: NP_036446
OMIM: 604955
HGNC: 6336
Ensembl: ENSG00000221957
Pharos: P43632(Tdark)
UniProt: P43632 A0A0C4ZN05
Structure
LinkDB
Position
19:54832707..54848575
AA seq 304 aa
MSLMVIIMACVGFFLLQGAWPQEGVHRKPSFLALPGHLVKSEETVILQCWSDVMFEHFLL
HREGKFNNTLHLIGEHHDGVSKANFSIGPMMPVLAGTYRCYGSVPHSPYQLSAPSDPLDM
VIIGLYEKPSLSAQPGPTVQAGENVTLSCSSRSSYDMYHLSREGEAHERRLPAVRSINGT
FQADFPLGPATHGGTYRCFGSFRDAPYEWSNSSDPLLVSVTGNPSNSWPSPTEPSSKTGN
PRHLHVLIGTSVVKIPFTILLFFLLHRWCSDKKNAAVMDQEPAGNRTVNSEDSDEQDHQE
VSYA
NT seq 915 nt   +upstreamnt  +downstreamnt
atgtcgctcatggtcatcatcatggcgtgtgttgggttcttcttgctgcagggggcctgg
ccacaggagggagtccacagaaaaccttccttcctggccctcccaggtcacctggtgaaa
tcagaagagacagtcatcctgcaatgttggtcggatgtcatgtttgagcacttccttctg
cacagagaggggaagtttaacaacactttgcacctcattggagagcaccatgatggggtt
tccaaggccaacttctccattggtcccatgatgcctgtccttgcaggaacctacagatgc
tacggttctgttcctcactccccctatcagttgtcagctcccagtgaccctctggacatg
gtgatcataggtctatatgagaaaccttctctctcagcccagccgggccccacggttcag
gcaggagagaatgtgaccttgtcctgcagctcccggagctcctatgacatgtaccatcta
tccagggaaggggaggcccatgaacgtaggctccctgcagtgcgcagcatcaacggaaca
ttccaggccgactttcctctgggccctgccacccacggagggacctacagatgcttcggc
tctttccgtgacgctccctacgagtggtcaaactcgagtgatccactgcttgtttccgtc
acaggaaacccttcaaatagttggccttcacccactgaaccaagctccaaaaccggtaac
cccagacacctacatgttctgattgggacctcagtggtcaaaatccctttcaccatcctc
ctcttctttctccttcatcgctggtgctccgacaaaaaaaatgctgctgtaatggaccaa
gagcctgcagggaacagaacagtgaacagcgaggattctgatgaacaagaccatcaggag
gtgtcatacgcataa

KEGG   Homo sapiens (human): 3810
Entry
3810              CDS       T01001                                 
Symbol
KIR2DS5, CD158G, NKAT9
Name
(RefSeq) killer cell immunoglobulin like receptor, two Ig domains and short cytoplasmic tail 5
  KO
K07982  killer cell immunoglobulin-like receptor 2DS
Organism
hsa  Homo sapiens (human)
Pathway
hsa04612  Antigen processing and presentation
hsa04650  Natural killer cell mediated cytotoxicity
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    3810 (KIR2DS5)
   04612 Antigen processing and presentation
    3810 (KIR2DS5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    3810 (KIR2DS5)
CD molecules [BR:hsa04090]
 Proteins
  3810 (KIR2DS5)
SSDB
Motif
Pfam: ig Ig_3 Ig_2
Other DBs
NCBI-GeneID: 3810
NCBI-ProteinID: NP_055328
OMIM: 604956
HGNC: 6337
UniProt: Q14953 A0A7D4Y677
LinkDB
Position
19q13.4
AA seq 304 aa
MSLMVISMACVAFFLLQGAWPHEGFRRKPSLLAHPGPLVKSEETVILQCWSDVMFEHFLL
HREGTFNHTLRLIGEHIDGVSKGNFSIGRMTQDLAGTYRCYGSVTHSPYQLSAPSDPLDI
VITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHERRLPAGPKVNRT
FQADFPLDPATHGGTYRCFGSFRDSPYEWSKSSDPLLVSVTGNSSNSWPSPTEPSSETGN
PRHLHVLIGTSVVKLPFTILLFFLLHRWCSNKKNASVMDQGPAGNRTVNREDSDEQDHQE
VSYA
NT seq 915 nt   +upstreamnt  +downstreamnt
atgtcgctcatggtcatcagcatggcgtgtgttgcgttcttcttgctgcagggggcctgg
ccacatgagggattccgcagaaaaccttccctcctggcccacccaggtcccctggtgaaa
tcagaagagacagtcatcctgcaatgttggtcagatgtcatgtttgagcacttccttctg
cacagagaggggacgtttaaccacactttgcgcctcattggagagcacattgatggggtc
tccaagggcaacttctccatcggtcgcatgacacaagacctggcagggacctacagatgc
tacggttctgttactcactccccctatcagttgtcagcgcccagtgaccctctggacatc
gtgatcacaggtctatatgagaaaccttctctctcagcccagccgggccccacggttctg
gcaggagagagcgtgaccttgtcctgcagctcccggagctcctatgacatgtaccatcta
tccagggaaggggaggcccatgaacgtaggctccctgcagggcccaaggtcaacagaaca
ttccaggccgactttcctctggaccctgccacccacggagggacctacagatgcttcggc
tctttccgtgactctccatacgagtggtcaaagtcaagtgacccactgcttgtttctgtc
acaggaaactcttcaaatagttggccttcacccactgaaccaagctccgaaaccggtaac
cccagacacctacacgttctgattgggacctcagtggtcaaactccctttcaccatcctc
ctcttctttctccttcatcgctggtgctccaacaaaaaaaatgcatctgtaatggaccaa
gggcctgcggggaacagaacagtgaacagggaggattctgatgaacaggaccatcaggag
gtgtcatacgcataa

DBGET integrated database retrieval system