KEGG   Homo sapiens (human): 100132463
Entry
100132463         CDS       T01001                                 
Symbol
CLDN24, CLDN21
Name
(RefSeq) claudin 24
  KO
K06087  claudin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules
hsa04530  Tight junction
hsa04670  Leukocyte transendothelial migration
hsa05130  Pathogenic Escherichia coli infection
hsa05160  Hepatitis C
Network
nt06135  Cytoskeletal regulation (viruses and bacteria)
  Element
N01287  Tight junction-Actin signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100132463 (CLDN24)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100132463 (CLDN24)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    100132463 (CLDN24)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    100132463 (CLDN24)
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    100132463 (CLDN24)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:hsa03037]
    100132463 (CLDN24)
   04147 Exosome [BR:hsa04147]
    100132463 (CLDN24)
Cilium and associated proteins [BR:hsa03037]
 Other cilia and associated proteins
  Stereociliary proteins
   100132463 (CLDN24)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   100132463 (CLDN24)
  Exosomal proteins of colorectal cancer cells
   100132463 (CLDN24)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 Clc-like
Other DBs
NCBI-GeneID: 100132463
NCBI-ProteinID: NP_001172078
HGNC: 37200
Ensembl: ENSG00000185758
Pharos: A6NM45(Tdark)
UniProt: A6NM45
LinkDB
Position
4:complement(183321764..183322426)
AA seq 220 aa
MALIFRTAMQSVGLLLSLLGWILSIITTYLPHWKNLNLDLNEMENWTMGLWQTCVIQEEV
GMQCKDFDSFLALPAELRVSRILMFLSNGLGFLGLLVSGFGLDCLRIGESQRDLKRRLLI
LGGILSWASGITALVPVSWVAHKTVQEFWDENVPDFVPRWEFGEALFLGWFAGLSLLLGG
CLLNCAACSSHAPLALGHYAVAQMQTQCPYLEDGTADPQV
NT seq 663 nt   +upstreamnt  +downstreamnt
atggctttaatctttagaacagcaatgcaatctgttggacttttactatctctcctggga
tggattttatccattattacaacttatttgccacactggaagaacctcaacctggactta
aatgaaatggaaaactggaccatgggactctggcaaacctgtgtcatccaagaggaagtg
gggatgcaatgcaaggactttgactccttcctggctttgcctgctgaactcagggtctcc
aggatcttaatgtttctgtcaaatgggctgggatttctgggcctgctggtctctgggttt
ggcctggactgtttgagaattggagagagtcagagagatctcaagaggcgactgctcatt
ctgggaggaattctgtcctgggcctcgggaatcacagccctggttcccgtctcttgggtt
gcccacaagacggttcaggagttctgggatgagaacgtcccagactttgtccccaggtgg
gagtttggggaggccctgtttctgggctggtttgctggactttctcttctgctaggaggg
tgtctgctcaactgcgcagcctgctccagccacgctcccctagctttgggccactatgca
gtggcgcaaatgcaaactcagtgtccctacctggaagatgggacagcagatcctcaagtg
taa

KEGG   Homo sapiens (human): 100288814
Entry
100288814         CDS       T01001                                 
Symbol
CLDN34
Name
(RefSeq) claudin 34
  KO
K06087  claudin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules
hsa04530  Tight junction
hsa04670  Leukocyte transendothelial migration
hsa05130  Pathogenic Escherichia coli infection
hsa05160  Hepatitis C
Network
nt06135  Cytoskeletal regulation (viruses and bacteria)
  Element
N01287  Tight junction-Actin signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100288814 (CLDN34)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100288814 (CLDN34)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    100288814 (CLDN34)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    100288814 (CLDN34)
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    100288814 (CLDN34)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:hsa03037]
    100288814 (CLDN34)
   04147 Exosome [BR:hsa04147]
    100288814 (CLDN34)
Cilium and associated proteins [BR:hsa03037]
 Other cilia and associated proteins
  Stereociliary proteins
   100288814 (CLDN34)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   100288814 (CLDN34)
  Exosomal proteins of colorectal cancer cells
   100288814 (CLDN34)
SSDB
Motif
Pfam: Claudin_2 PMP22_Claudin
Other DBs
NCBI-GeneID: 100288814
NCBI-ProteinID: NP_001182010
HGNC: 51259
Ensembl: ENSG00000234469
Pharos: H7C241(Tdark)
UniProt: H7C241
LinkDB
Position
X:9967358..9968352
AA seq 214 aa
MVWFCNSADCQFSVFALTTIGWILSSTSTGLVEWRIWYMKDTSLYPPGIACVGIFRVCIY
RRRTNSTTTKFCYRYSYQDTFLPFEISMAQRFLLTASIFGFFGRAFNMFALRNMSMRMFE
EDTYNSFVVSGILNIAAGVFNLIAVLQNYDAVINSQGITFLPSLQMPFKPDVQEVGTAIQ
VAGIGVLPMLLTGMFSLFYKCPPYGQVHPGISEM
NT seq 645 nt   +upstreamnt  +downstreamnt
atggtctggttctgcaacagtgccgactgccaattttcagtcttcgcccttaccaccata
ggatggatcctctcctctacgtccacgggcctcgtggagtggcgaatatggtacatgaaa
gacacctcgctctacccccctggaatcgcctgcgtgggaatatttagagtctgcatttac
cggcgtcgcaccaacagcaccacaaccaaattttgttaccgatacagctaccaggacacc
tttctcccttttgaaatttccatggctcaacgcttcctactgactgccagcattttcgga
ttcttcgggagagcctttaacatgtttgcacttagaaacatgtccatgagaatgtttgag
gaggacacctacaattcattcgttgtttcaggaattctcaacattgctgctggtgtcttt
aacttaattgctgtgctccagaactacgatgccgtcataaactcacaggggatcaccttc
ctgccatctctccaaatgcccttcaagccagatgtgcaggaagttggcactgccattcaa
gtggcagggataggtgtcttgccgatgctgttaactgggatgttttctctgttttacaaa
tgtcccccgtacggccaagtgcatcctggtatttcagaaatgtga

KEGG   Homo sapiens (human): 10686
Entry
10686             CDS       T01001                                 
Symbol
CLDN16, HOMG3, PCLN1
Name
(RefSeq) claudin 16
  KO
K06087  claudin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules
hsa04530  Tight junction
hsa04670  Leukocyte transendothelial migration
hsa05130  Pathogenic Escherichia coli infection
hsa05160  Hepatitis C
Network
nt06135  Cytoskeletal regulation (viruses and bacteria)
  Element
N01287  Tight junction-Actin signaling pathway
Disease
H01210  Hypomagnesemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    10686 (CLDN16)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    10686 (CLDN16)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    10686 (CLDN16)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    10686 (CLDN16)
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    10686 (CLDN16)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:hsa03037]
    10686 (CLDN16)
   04147 Exosome [BR:hsa04147]
    10686 (CLDN16)
Cilium and associated proteins [BR:hsa03037]
 Other cilia and associated proteins
  Stereociliary proteins
   10686 (CLDN16)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   10686 (CLDN16)
  Exosomal proteins of colorectal cancer cells
   10686 (CLDN16)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 Clc-like
Other DBs
NCBI-GeneID: 10686
NCBI-ProteinID: NP_006571
OMIM: 603959
HGNC: 2037
Ensembl: ENSG00000113946
Pharos: Q9Y5I7(Tbio)
UniProt: Q9Y5I7
LinkDB
Position
3:190290361..190412138
AA seq 235 aa
MRDLLQYIACFFAFFSAGFLIVATWTDCWMVNADDSLEVSTKCRGLWWECVTNAFDGIRT
CDEYDSILAEHPLKLVVTRALMITADILAGFGFLTLLLGLDCVKFLPDEPYIKVRICFVA
GATLLIAGTPGIIGSVWYAVDVYVERSTLVLHNIFLGIQYKFGWSCWLGMAGSLGCFLAG
AVLTCCLYLFKDVGPERNYPYSLRKAYSAAGVSMAKSYSAPRTETAKMYAVDTRV
NT seq 708 nt   +upstreamnt  +downstreamnt
atgagggatcttcttcaatacatcgcttgcttctttgcctttttctctgctgggtttttg
attgtggccacctggactgactgttggatggtgaatgctgatgactctctggaggtgagc
acaaaatgccgaggcctctggtgggaatgcgtcacaaatgcttttgatgggattcgcacc
tgtgatgagtacgattccatacttgcggagcatcccttgaagctggtggtaactcgagcg
ttgatgattactgcagatattctagctgggtttggatttctcaccctgctccttggtctt
gactgcgtgaaattcctccctgatgagccgtacattaaagtccgcatctgctttgttgct
ggagccacgttactaatagcaggtaccccaggaatcattggctctgtgtggtatgctgtt
gatgtgtatgtggaacgttctactttggttttgcacaatatatttcttggtatccaatat
aaatttggttggtcctgttggctcggaatggctgggtctctgggttgctttttggctgga
gctgttctcacctgctgcttatatctttttaaagatgttggacctgagagaaactatcct
tattccttgaggaaagcctattcagccgcgggtgtttccatggccaagtcatactcagcc
cctcgcacagagacggccaaaatgtatgctgtagacacaagggtgtaa

KEGG   Homo sapiens (human): 1364
Entry
1364              CDS       T01001                                 
Symbol
CLDN4, CPE-R, CPER, CPETR, CPETR1, WBSCR8, hCPE-R
Name
(RefSeq) claudin 4
  KO
K06087  claudin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules
hsa04530  Tight junction
hsa04670  Leukocyte transendothelial migration
hsa05130  Pathogenic Escherichia coli infection
hsa05160  Hepatitis C
Network
nt06135  Cytoskeletal regulation (viruses and bacteria)
  Element
N01287  Tight junction-Actin signaling pathway
Disease
H01439  Williams-Beuren syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    1364 (CLDN4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    1364 (CLDN4)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    1364 (CLDN4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    1364 (CLDN4)
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    1364 (CLDN4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:hsa03037]
    1364 (CLDN4)
   04147 Exosome [BR:hsa04147]
    1364 (CLDN4)
Cilium and associated proteins [BR:hsa03037]
 Other cilia and associated proteins
  Stereociliary proteins
   1364 (CLDN4)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   1364 (CLDN4)
  Exosomal proteins of colorectal cancer cells
   1364 (CLDN4)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 TMEM37 TMEM_230_134 DUF4131 Amastin
Other DBs
NCBI-GeneID: 1364
NCBI-ProteinID: NP_001296
OMIM: 602909
HGNC: 2046
Ensembl: ENSG00000189143
Pharos: O14493(Tbio)
UniProt: O14493 Q75L80
Structure
LinkDB
Position
7:73830996..73832690
AA seq 209 aa
MASMGLQVMGIALAVLGWLAVMLCCALPMWRVTAFIGSNIVTSQTIWEGLWMNCVVQSTG
QMQCKVYDSLLALPQDLQAARALVIISIIVAALGVLLSVVGGKCTNCLEDESAKAKTMIV
AGVVFLLAGLMVIVPVSWTAHNIIQDFYNPLVASGQKREMGASLYVGWAASGLLLLGGGL
LCCNCPPRTDKPYSAKYSAARSAAASNYV
NT seq 630 nt   +upstreamnt  +downstreamnt
atggcctccatggggctacaggtaatgggcatcgcgctggccgtcctgggctggctggcc
gtcatgctgtgctgcgcgctgcccatgtggcgcgtgacggccttcatcggcagcaacatt
gtcacctcgcagaccatctgggagggcctatggatgaactgcgtggtgcagagcaccggc
cagatgcagtgcaaggtgtacgactcgctgctggcactgccgcaggacctgcaggcggcc
cgcgccctcgtcatcatcagcatcatcgtggctgctctgggcgtgctgctgtccgtggtg
gggggcaagtgtaccaactgcctggaggatgaaagcgccaaggccaagaccatgatcgtg
gcgggcgtggtgttcctgttggccggccttatggtgatagtgccggtgtcctggacggcc
cacaacatcatccaagacttctacaatccgctggtggcctccgggcagaagcgggagatg
ggtgcctcgctctacgtcggctgggccgcctccggcctgctgctccttggcggggggctg
ctttgctgcaactgtccaccccgcacagacaagccttactccgccaagtattctgctgcc
cgctctgctgctgccagcaactacgtgtaa

KEGG   Homo sapiens (human): 1365
Entry
1365              CDS       T01001                                 
Symbol
CLDN3, C7orf1, CPE-R2, CPETR2, HRVP1, RVP1
Name
(RefSeq) claudin 3
  KO
K06087  claudin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules
hsa04530  Tight junction
hsa04670  Leukocyte transendothelial migration
hsa05130  Pathogenic Escherichia coli infection
hsa05160  Hepatitis C
Network
nt06135  Cytoskeletal regulation (viruses and bacteria)
  Element
N01287  Tight junction-Actin signaling pathway
Disease
H01439  Williams-Beuren syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    1365 (CLDN3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    1365 (CLDN3)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    1365 (CLDN3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    1365 (CLDN3)
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    1365 (CLDN3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:hsa03037]
    1365 (CLDN3)
   04147 Exosome [BR:hsa04147]
    1365 (CLDN3)
Cilium and associated proteins [BR:hsa03037]
 Other cilia and associated proteins
  Stereociliary proteins
   1365 (CLDN3)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   1365 (CLDN3)
  Exosomal proteins of colorectal cancer cells
   1365 (CLDN3)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 L_HMGIC_fpl TMEM37 Phage_holin_3_6 DUF6239
Other DBs
NCBI-GeneID: 1365
NCBI-ProteinID: NP_001297
OMIM: 602910
HGNC: 2045
Ensembl: ENSG00000165215
Pharos: O15551(Tbio)
UniProt: O15551 Q75L79
LinkDB
Position
7:complement(73768997..73770270)
AA seq 220 aa
MSMGLEITGTALAVLGWLGTIVCCALPMWRVSAFIGSNIITSQNIWEGLWMNCVVQSTGQ
MQCKVYDSLLALPQDLQAARALIVVAILLAAFGLLVALVGAQCTNCVQDDTAKAKITIVA
GVLFLLAALLTLVPVSWSANTIIRDFYNPVVPEAQKREMGAGLYVGWAAAALQLLGGALL
CCSCPPREKKYTATKVVYSAPRSTGPGASLGTGYDRKDYV
NT seq 663 nt   +upstreamnt  +downstreamnt
atgtccatgggcctggagatcacgggcaccgcgctggccgtgctgggctggctgggcacc
atcgtgtgctgcgcgttgcccatgtggcgcgtgtcggccttcatcggcagcaacatcatc
acgtcgcagaacatctgggagggcctgtggatgaactgcgtggtgcagagcaccggccag
atgcagtgcaaggtgtacgactcgctgctggcactgccacaggaccttcaggcggcccgc
gccctcatcgtggtggccatcctgctggccgccttcgggctgctagtggcgctggtgggc
gcccagtgcaccaactgcgtgcaggacgacacggccaaggccaagatcaccatcgtggca
ggcgtgctgttccttctcgccgccctgctcaccctcgtgccggtgtcctggtcggccaac
accattatccgggacttctacaaccccgtggtgcccgaggcgcagaagcgcgagatgggc
gcgggcctgtacgtgggctgggcggccgcggcgctgcagctgctggggggcgcgctgctc
tgctgctcgtgtcccccacgcgagaagaagtacacggccaccaaggtcgtctactccgcg
ccgcgctccaccggcccgggagccagcctgggcacaggctacgaccgcaaggactacgtc
taa

KEGG   Homo sapiens (human): 1366
Entry
1366              CDS       T01001                                 
Symbol
CLDN7, CEPTRL2, CLDN-7, CPETRL2, Hs.84359, claudin-1
Name
(RefSeq) claudin 7
  KO
K06087  claudin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules
hsa04530  Tight junction
hsa04670  Leukocyte transendothelial migration
hsa05130  Pathogenic Escherichia coli infection
hsa05160  Hepatitis C
Network
nt06135  Cytoskeletal regulation (viruses and bacteria)
  Element
N01287  Tight junction-Actin signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    1366 (CLDN7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    1366 (CLDN7)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    1366 (CLDN7)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    1366 (CLDN7)
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    1366 (CLDN7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:hsa03037]
    1366 (CLDN7)
   04147 Exosome [BR:hsa04147]
    1366 (CLDN7)
Cilium and associated proteins [BR:hsa03037]
 Other cilia and associated proteins
  Stereociliary proteins
   1366 (CLDN7)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   1366 (CLDN7)
  Exosomal proteins of colorectal cancer cells
   1366 (CLDN7)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 SUR7 Clc-like Amastin OppC_N
Other DBs
NCBI-GeneID: 1366
NCBI-ProteinID: NP_001171951
OMIM: 609131
HGNC: 2049
Ensembl: ENSG00000181885
Pharos: O95471(Tbio)
UniProt: O95471 A0A384ME58
LinkDB
Position
17:complement(7259903..7263213)
AA seq 211 aa
MANSGLQLLGFSMALLGWVGLVACTAIPQWQMSSYAGDNIITAQAMYKGLWMDCVTQSTG
MMSCKMYDSVLALSAALQATRALMVVSLVLGFLAMFVATMGMKCTRCGGDDKVKKARIAM
GGGIIFIVAGLAALVACSWYGHQIVTDFYNPLIPTNIKYEFGPAIFIGWAGSALVILGGA
LLSCSCPGNESKAGYRVPRSYPKSNSSKEYV
NT seq 636 nt   +upstreamnt  +downstreamnt
atggccaattcgggcctgcagttgctgggcttctccatggccctgctgggctgggtgggt
ctggtggcctgcaccgccatcccgcagtggcagatgagctcctatgcgggtgacaacatc
atcacggcccaggccatgtacaaggggctgtggatggactgcgtcacgcagagcacgggg
atgatgagctgcaaaatgtacgactcggtgctcgccctgtccgcggccttgcaggccact
cgagccctaatggtggtctccctggtgctgggcttcctggccatgtttgtggccacgatg
ggcatgaagtgcacgcgctgtgggggagacgacaaagtgaagaaggcccgtatagccatg
ggtggaggcataattttcatcgtggcaggtcttgccgccttggtagcttgctcctggtat
ggccatcagattgtcacagacttttataaccctttgatccctaccaacattaagtatgag
tttggccctgccatctttattggctgggcagggtctgccctagtcatcctgggaggtgca
ctgctctcctgttcctgtcctgggaatgagagcaaggctgggtaccgtgtaccccgctct
taccctaagtccaactcttccaaggagtatgtgtga

KEGG   Homo sapiens (human): 137075
Entry
137075            CDS       T01001                                 
Symbol
CLDN23, CLDNL, hCG1646163
Name
(RefSeq) claudin 23
  KO
K06087  claudin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules
hsa04530  Tight junction
hsa04670  Leukocyte transendothelial migration
hsa05130  Pathogenic Escherichia coli infection
hsa05160  Hepatitis C
Network
nt06135  Cytoskeletal regulation (viruses and bacteria)
  Element
N01287  Tight junction-Actin signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    137075 (CLDN23)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    137075 (CLDN23)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    137075 (CLDN23)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    137075 (CLDN23)
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    137075 (CLDN23)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:hsa03037]
    137075 (CLDN23)
   04147 Exosome [BR:hsa04147]
    137075 (CLDN23)
Cilium and associated proteins [BR:hsa03037]
 Other cilia and associated proteins
  Stereociliary proteins
   137075 (CLDN23)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   137075 (CLDN23)
  Exosomal proteins of colorectal cancer cells
   137075 (CLDN23)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 Yip1 TMEM_230_134
Other DBs
NCBI-GeneID: 137075
NCBI-ProteinID: NP_919260
OMIM: 609203
HGNC: 17591
Ensembl: ENSG00000253958
Pharos: Q96B33(Tbio)
UniProt: Q96B33
LinkDB
Position
8:8701937..8704096
AA seq 292 aa
MRTPVVMTLGMVLAPCGLLLNLTGTLAPGWRLVKGFLNQPVDVELYQGLWDMCREQSSRE
RECGQTDQWGYFEAQPVLVARALMVTSLAATVLGLLLASLGVRCWQDEPNFVLAGLSGVV
LFVAGLLGLIPVSWYNHFLGDRDVLPAPASPVTVQVSYSLVLGYLGSCLLLLGGFSLALS
FAPWCDERCRRRRKGPSAGPRRSSVSTIQVEWPEPDLAPAIKYYSDGQHRPPPAQHRKPK
PKPKVGFPMPRPRPKAYTNSVDVLDGEGWESQDAPSCSTHPCDSSLPCDSDL
NT seq 879 nt   +upstreamnt  +downstreamnt
atgcggacgccggtggtgatgacgctgggcatggtgttggcgccctgcgggctcctgctc
aacctgaccggcaccctggcgcccggctggcggctggtgaagggcttcctgaaccagcca
gtggacgtggagttgtaccagggcctgtgggacatgtgtcgcgagcagagcagccgcgag
cgcgagtgcggccagacggaccagtggggctacttcgaggcccagcccgtgctggtggcg
cgggcactcatggtcacctcgctggccgccacggtcctggggcttctgctggcgtcgctg
ggcgtgcgctgctggcaggacgagcccaacttcgtgctggcagggctctcgggcgtcgtg
ctcttcgtcgctggcctcctcggcctcatcccggtgtcctggtacaaccacttcttgggg
gaccgcgacgtgctgcccgccccggccagcccggtcacggtgcaggtcagctacagcctg
gtcctgggctacctgggcagctgcctcctgctgctgggcggcttctcgctggcgctcagc
ttcgcgccctggtgcgacgagcgttgtcgccgccgccgcaagggaccctccgccgggcct
cgccgcagcagcgtcagcaccatccaagtggagtggcccgagcccgacctggcgcccgcc
atcaagtactacagcgacggccagcaccgaccgccgcctgcccagcaccgcaagcccaag
cccaagcccaaggtcggcttccccatgccgcggccgcggcccaaggcctacaccaactcg
gtggacgtcctcgacggggaggggtgggagtcccaggacgctccctcgtgcagcacccac
ccctgcgacagctcgctgccctgcgactccgacctctag

KEGG   Homo sapiens (human): 149461
Entry
149461            CDS       T01001                                 
Symbol
CLDN19, HOMG5
Name
(RefSeq) claudin 19
  KO
K06087  claudin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules
hsa04530  Tight junction
hsa04670  Leukocyte transendothelial migration
hsa05130  Pathogenic Escherichia coli infection
hsa05160  Hepatitis C
Network
nt06135  Cytoskeletal regulation (viruses and bacteria)
  Element
N01287  Tight junction-Actin signaling pathway
Disease
H01210  Hypomagnesemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    149461 (CLDN19)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    149461 (CLDN19)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    149461 (CLDN19)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    149461 (CLDN19)
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    149461 (CLDN19)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:hsa03037]
    149461 (CLDN19)
   04147 Exosome [BR:hsa04147]
    149461 (CLDN19)
Cilium and associated proteins [BR:hsa03037]
 Other cilia and associated proteins
  Stereociliary proteins
   149461 (CLDN19)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   149461 (CLDN19)
  Exosomal proteins of colorectal cancer cells
   149461 (CLDN19)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 Amastin Mntp SUR7
Other DBs
NCBI-GeneID: 149461
NCBI-ProteinID: NP_683763
OMIM: 610036
HGNC: 2040
Ensembl: ENSG00000164007
Pharos: Q8N6F1(Tbio)
UniProt: Q8N6F1
LinkDB
Position
1:complement(42733093..42740236)
AA seq 224 aa
MANSGLQLLGYFLALGGWVGIIASTALPQWKQSSYAGDAIITAVGLYEGLWMSCASQSTG
QVQCKLYDSLLALDGHIQSARALMVVAVLLGFVAMVLSVVGMKCTRVGDSNPIAKGRVAI
AGGALFILAGLCTLTAVSWYATLVTQEFFNPSTPVNARYEFGPALFVGWASAGLAVLGGS
FLCCTCPEPERPNSSPQPYRPGPSAAAREPVVKLPASAKGPLGV
NT seq 675 nt   +upstreamnt  +downstreamnt
atggccaactcaggcctccagctcctgggctacttcttggccctgggtggctgggtgggc
atcattgctagcacagccctgccacagtggaagcagtcttcctacgcaggcgacgccatc
atcactgccgtgggcctctatgaagggctctggatgtcctgcgcctcccagagcactggg
caagtgcagtgcaagctctacgactcgctgctcgccctggacggtcacatccaatcagcg
cgggccctgatggtggtggccgtgctcctgggcttcgtggccatggtcctcagcgtagtt
ggcatgaagtgtacgcgggtgggagacagcaaccccattgccaagggccgtgttgccatc
gccgggggagccctcttcatcctggcaggcctctgcactttgactgctgtctcgtggtat
gccaccctggtgacccaggagttcttcaacccaagcacacctgtcaatgccaggtatgaa
tttggcccagccctgttcgtgggctgggcctcagctggcctggccgtgctgggcggctcc
ttcctctgctgcacatgcccggagccagagagacccaacagcagcccacagccctatcgg
cctggaccctctgctgctgcccgagaaccagttgttaaattgcccgcctccgccaagggc
cccctgggtgtgtaa

KEGG   Homo sapiens (human): 23562
Entry
23562             CDS       T01001                                 
Symbol
CLDN14, DFNB29
Name
(RefSeq) claudin 14
  KO
K06087  claudin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules
hsa04530  Tight junction
hsa04670  Leukocyte transendothelial migration
hsa05130  Pathogenic Escherichia coli infection
hsa05160  Hepatitis C
Network
nt06135  Cytoskeletal regulation (viruses and bacteria)
  Element
N01287  Tight junction-Actin signaling pathway
Disease
H00605  Deafness, autosomal recessive
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    23562 (CLDN14)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    23562 (CLDN14)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    23562 (CLDN14)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    23562 (CLDN14)
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    23562 (CLDN14)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:hsa03037]
    23562 (CLDN14)
   04147 Exosome [BR:hsa04147]
    23562 (CLDN14)
Cilium and associated proteins [BR:hsa03037]
 Other cilia and associated proteins
  Stereociliary proteins
   23562 (CLDN14)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   23562 (CLDN14)
  Exosomal proteins of colorectal cancer cells
   23562 (CLDN14)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 Amastin Laminin_EGF
Other DBs
NCBI-GeneID: 23562
NCBI-ProteinID: NP_001139549
OMIM: 605608
HGNC: 2035
Ensembl: ENSG00000159261
Pharos: O95500(Tbio)
UniProt: O95500
LinkDB
Position
21:complement(36460621..36576569)
AA seq 239 aa
MASTAVQLLGFLLSFLGMVGTLITTILPHWRRTAHVGTNILTAVSYLKGLWMECVWHSTG
IYQCQIYRSLLALPQDLQAARALMVISCLLSGIACACAVIGMKCTRCAKGTPAKTTFAIL
GGTLFILAGLLCMVAVSWTTNDVVQNFYNPLLPSGMKFEIGQALYLGFISSSLSLIGGTL
LCLSCQDEAPYRPYQAPPRATTTTANTAPAYQPPAAYKDNRAPSVTSATHSGYRLNDYV
NT seq 720 nt   +upstreamnt  +downstreamnt
atggccagcacggccgtgcagcttctgggcttcctgctcagcttcctgggcatggtgggc
acgttgatcaccaccatcctgccgcactggcggaggacagcgcacgtgggcaccaacatc
ctcacggccgtgtcctacctgaaagggctctggatggagtgtgtgtggcacagcacaggc
atctaccagtgccagatctaccgatccctgctggcgctgccccaagacctccaggctgcc
cgcgccctcatggtcatctcctgcctgctctcgggcatagcctgcgcctgcgccgtcatc
gggatgaagtgcacgcgctgcgccaagggcacacccgccaagaccacctttgccatcctc
ggcggcaccctcttcatcctggccggcctcctgtgcatggtggccgtctcctggaccacc
aacgacgtggtgcagaacttctacaacccgctgctgcccagcggcatgaagtttgagatt
ggccaggccctgtacctgggcttcatctcctcgtccctctcgctcattggtggcaccctg
ctttgcctgtcctgccaggacgaggcaccctacaggccctaccaggccccgcccagggcc
accacgaccactgcaaacaccgcacctgcctaccagccaccagctgcctacaaagacaat
cgggccccctcagtgacctcggccacgcacagcgggtacaggctgaacgactacgtgtga

KEGG   Homo sapiens (human): 24146
Entry
24146             CDS       T01001                                 
Symbol
CLDN15
Name
(RefSeq) claudin 15
  KO
K06087  claudin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules
hsa04530  Tight junction
hsa04670  Leukocyte transendothelial migration
hsa05130  Pathogenic Escherichia coli infection
hsa05160  Hepatitis C
Network
nt06135  Cytoskeletal regulation (viruses and bacteria)
  Element
N01287  Tight junction-Actin signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    24146 (CLDN15)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    24146 (CLDN15)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    24146 (CLDN15)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    24146 (CLDN15)
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    24146 (CLDN15)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:hsa03037]
    24146 (CLDN15)
   04147 Exosome [BR:hsa04147]
    24146 (CLDN15)
Cilium and associated proteins [BR:hsa03037]
 Other cilia and associated proteins
  Stereociliary proteins
   24146 (CLDN15)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   24146 (CLDN15)
  Exosomal proteins of colorectal cancer cells
   24146 (CLDN15)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2
Other DBs
NCBI-GeneID: 24146
NCBI-ProteinID: NP_001172009
OMIM: 615778
HGNC: 2036
Ensembl: ENSG00000106404
Pharos: P56746(Tbio)
UniProt: P56746
LinkDB
Position
7:complement(101232094..101238820)
AA seq 228 aa
MSMAVETFGFFMATVGLLMLGVTLPNSYWRVSTVHGNVITTNTIFENLWFSCATDSLGVY
NCWEFPSMLALSGYIQACRALMITAILLGFLGLLLGIAGLRCTNIGGLELSRKAKLAATA
GALHILAGICGMVAISWYAFNITRDFFDPLYPGTKYELGPALYLGWSASLISILGGLCLC
SACCCGSDEDPAASARRPYQAPVSVMPVATSDQEGDSSFGKYGRNAYV
NT seq 687 nt   +upstreamnt  +downstreamnt
atgtcgatggctgtggaaacctttggcttcttcatggcaactgtggggctgctgatgctg
ggggtgactctgccaaacagctactggcgagtgtccactgtgcacgggaacgtcatcacc
accaacaccatcttcgagaacctctggtttagctgtgccaccgactccctgggcgtctac
aactgctgggagttcccgtccatgctggccctctctgggtatattcaggcctgccgggca
ctcatgatcaccgccatcctcctgggcttcctcggcctcttgctaggcatagcgggcctg
cgctgcaccaacattgggggcctggagctctccaggaaagccaagctggcggccaccgca
ggggccctccacattctggccggtatctgcgggatggtggccatctcctggtacgccttc
aacatcacccgggacttcttcgaccccttgtaccccggaaccaagtacgagctgggcccc
gccctctacctggggtggagcgcctcactgatctccatcctgggtggcctctgcctctgc
tccgcctgctgctgcggctctgacgaggacccagccgccagcgcccggcggccctaccag
gctccagtgtccgtgatgcccgtcgccacctcggaccaagaaggcgacagcagctttggc
aaatacggcagaaacgcctacgtgtag

DBGET integrated database retrieval system