KEGG   Homo sapiens (human): 100137049
Entry
100137049         CDS       T01001                                 
Symbol
PLA2G4B, HsT16992, cPLA2-beta
Name
(RefSeq) phospholipase A2 group IVB
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00564  Glycerophospholipid metabolism
hsa00565  Ether lipid metabolism
hsa00590  Arachidonic acid metabolism
hsa00591  Linoleic acid metabolism
hsa00592  alpha-Linolenic acid metabolism
hsa01100  Metabolic pathways
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04217  Necroptosis
hsa04270  Vascular smooth muscle contraction
hsa04370  VEGF signaling pathway
hsa04611  Platelet activation
hsa04664  Fc epsilon RI signaling pathway
hsa04666  Fc gamma R-mediated phagocytosis
hsa04724  Glutamatergic synapse
hsa04726  Serotonergic synapse
hsa04730  Long-term depression
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04912  GnRH signaling pathway
hsa04913  Ovarian steroidogenesis
hsa04921  Oxytocin signaling pathway
hsa05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    100137049 (PLA2G4B)
   00565 Ether lipid metabolism
    100137049 (PLA2G4B)
   00590 Arachidonic acid metabolism
    100137049 (PLA2G4B)
   00591 Linoleic acid metabolism
    100137049 (PLA2G4B)
   00592 alpha-Linolenic acid metabolism
    100137049 (PLA2G4B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100137049 (PLA2G4B)
   04014 Ras signaling pathway
    100137049 (PLA2G4B)
   04370 VEGF signaling pathway
    100137049 (PLA2G4B)
   04072 Phospholipase D signaling pathway
    100137049 (PLA2G4B)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100137049 (PLA2G4B)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100137049 (PLA2G4B)
   04664 Fc epsilon RI signaling pathway
    100137049 (PLA2G4B)
   04666 Fc gamma R-mediated phagocytosis
    100137049 (PLA2G4B)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100137049 (PLA2G4B)
   04913 Ovarian steroidogenesis
    100137049 (PLA2G4B)
   04921 Oxytocin signaling pathway
    100137049 (PLA2G4B)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100137049 (PLA2G4B)
  09156 Nervous system
   04724 Glutamatergic synapse
    100137049 (PLA2G4B)
   04726 Serotonergic synapse
    100137049 (PLA2G4B)
   04730 Long-term depression
    100137049 (PLA2G4B)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100137049 (PLA2G4B)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    100137049 (PLA2G4B)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     100137049 (PLA2G4B)
SSDB
Motif
Pfam: PLA2_B cPLA2_C2 C2
Other DBs
NCBI-GeneID: 100137049
NCBI-ProteinID: NP_001108105
OMIM: 606088
HGNC: 9036
Ensembl: ENSG00000243708
UniProt: P0C869
LinkDB
Position
15:41838847..41848143
AA seq 781 aa
MAVAEVSRTCLLTVRVLQAHRLPSKDLVTPSDCYVTLWLPTACSHRLQTRTVKNSSSPVW
NQSFHFRIHRQLKNVMELKVFDQDLVTGDDPVLSVLFDAGTLRAGEFRRESFSLSPQGEG
RLEVEFRLQSLADRGEWLVSNGVLVARELSCLHVQLEETGDQKSSEHRVQLVVPGSCEGP
QEASVGTGTFRFHCPACWEQELSIRLQDAPEEQLKAPLSALPSGQVVRLVFPTSQEPLMR
VELKKEAGLRELAVRLGFGPCAEEQAFLSRRKQVVAAALRQALQLDGDLQEDEIPVVAIM
ATGGGIRAMTSLYGQLAGLKELGLLDCVSYITGASGSTWALANLYEDPEWSQKDLAGPTE
LLKTQVTKNKLGVLAPSQLQRYRQELAERARLGYPSCFTNLWALINEALLHDEPHDHKLS
DQREALSHGQNPLPIYCALNTKGQSLTTFEFGEWCEFSPYEVGFPKYGAFIPSELFGSEF
FMGQLMKRLPESRICFLEGIWSNLYAANLQDSLYWASEPSQFWDRWVRNQANLDKEQVPL
LKIEEPPSTAGRIAEFFTDLLTWRPLAQATHNFLRGLHFHKDYFQHPHFSTWKATTLDGL
PNQLTPSEPHLCLLDVGYLINTSCLPLLQPTRDVDLILSLDYNLHGAFQQLQLLGRFCQE
QGIPFPPISPSPEEQLQPRECHTFSDPTCPGAPAVLHFPLVSDSFREYSAPGVRRTPEEA
AAGEVNLSSSDSPYHYTKVTYSQEDVDKLLHLTHYNVCNNQEQLLEALRQAVQRRRQRRP
H
NT seq 2346 nt   +upstreamnt  +downstreamnt
atggctgtggcagaggtgtccaggacctgcctgctcacggttcgtgtcctgcaggcccat
cgcctaccctctaaggacctagtgaccccctctgactgctacgtgactctctggctgccc
acggcctgcagccacaggctccagacacgcacggtcaagaacagcagtagccctgtctgg
aaccagagctttcacttcaggatccacaggcagctcaagaatgtcatggaactgaaagtc
tttgaccaggacctggtgaccggagatgaccctgtgttgtcagtactgtttgatgcgggg
actctgcgggctggggagttccggcgcgagagcttctcactgagccctcagggtgagggg
cgcctggaagttgaatttcgcctgcagagtctggctgaccgtggcgagtggctcgtcagc
aatggcgttctggtggcccgggagctctcctgcttgcacgttcaactggaggagacagga
gaccagaagtcctcagagcacagagttcagcttgtggttcctgggtcctgtgagggtccg
caggaggcctctgtgggcactggcaccttccgcttccactgcccagcctgctgggagcag
gagctgagtattcgcctgcaggatgcccccgaggagcaactaaaggcgccactgagtgcc
ctgccctctggtcaagtggtgaggcttgtcttccccacgtcccaggagcccctgatgaga
gtggagctgaaaaaagaagcaggactgagggagctggccgtgcgactgggcttcgggccc
tgtgcagaggagcaggccttcctgagcaggaggaagcaggtggtggccgcggccttgagg
caggccctgcagctggacggagacctgcaggaggatgagatcccagtggtagctattatg
gccactggtggtgggatccgggcaatgacttccctgtatgggcagctggctggcctgaag
gagctgggcctcttggattgcgtctcctacatcaccggggcctcgggctccacctgggcc
ttggccaacctttatgaggacccagagtggtctcagaaggacctggcagggcccactgag
ttgctgaagacccaggtgaccaagaacaagctgggtgtgctggcccccagccagctgcag
cggtaccggcaggagctggccgagcgtgcccgcttgggctacccaagctgcttcaccaac
ctgtgggccctcatcaacgaggcgctgctgcatgatgagccccatgatcacaagctctca
gatcaacgggaggccctgagtcatggccagaaccctctgcccatctactgtgccctcaac
accaaagggcagagcctgaccacttttgaatttggggagtggtgcgagttctctccctac
gaggtcggcttccccaagtacggggccttcatcccctctgagctctttggctccgagttc
tttatggggcagctgatgaagaggcttcctgagtcccgcatctgcttcttagaaggtatc
tggagcaacctgtatgcagccaacctccaggacagcttatactgggcctcagagcccagc
cagttctgggaccgctgggtcaggaaccaggccaacctggacaaggagcaggtccccctt
ctgaagatagaagaaccaccctcaacagccggcaggatagctgagtttttcaccgatctt
ctgacgtggcgtccactggcccaggccacacataatttcctgcgtggcctccatttccac
aaagactactttcagcatcctcacttctccacatggaaagctaccactctggatgggctc
cccaaccagctgacaccctcggagccccacctgtgcctgctggatgttggctacctcatc
aataccagctgcctgcccctcctgcagcccactcgggacgtggacctcatcctgtcattg
gactacaacctccacggagccttccagcagttgcagctcctgggccggttctgccaggag
caggggatcccgttcccacccatctcgcccagccccgaagagcagctccagcctcgggag
tgccacaccttctccgaccccacctgccccggagcccctgcggtgctgcactttcctctg
gtcagcgactccttccgggagtactcggcccctggggtccggcggacacccgaggaggcg
gcagctggggaggtgaacctgtcttcatcggactctccctaccactacacgaaggtgacc
tacagccaggaggacgtggacaagctgctgcacctgacacattacaatgtctgcaacaac
caggagcagctgctggaggctctgcgccaggcagtgcagcggaggcggcagcgcaggccc
cactga

KEGG   Homo sapiens (human): 11145
Entry
11145             CDS       T01001                                 
Symbol
PLAAT3, AdPLA, H-REV107, H-REV107-1, HRASLS3, HREV107, HREV107-1, HREV107-3, HRSL3, PLA2G16, PLAAT-3
Name
(RefSeq) phospholipase A and acyltransferase 3
  KO
K16817  HRAS-like suppressor 3 [EC:3.1.1.32 3.1.1.4]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00564  Glycerophospholipid metabolism
hsa00565  Ether lipid metabolism
hsa00590  Arachidonic acid metabolism
hsa00591  Linoleic acid metabolism
hsa00592  alpha-Linolenic acid metabolism
hsa01100  Metabolic pathways
hsa04014  Ras signaling pathway
hsa04923  Regulation of lipolysis in adipocytes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    11145 (PLAAT3)
   00565 Ether lipid metabolism
    11145 (PLAAT3)
   00590 Arachidonic acid metabolism
    11145 (PLAAT3)
   00591 Linoleic acid metabolism
    11145 (PLAAT3)
   00592 alpha-Linolenic acid metabolism
    11145 (PLAAT3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    11145 (PLAAT3)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    11145 (PLAAT3)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     11145 (PLAAT3)
    3.1.1.32  phospholipase A1
     11145 (PLAAT3)
SSDB
Motif
Pfam: LRAT Calici_PP_N Peptidase_C97 Churchill
Other DBs
NCBI-GeneID: 11145
NCBI-ProteinID: NP_001121675
OMIM: 613867
HGNC: 17825
Ensembl: ENSG00000176485
Pharos: P53816(Tbio)
UniProt: P53816 A0A024R561
Structure
LinkDB
Position
11:complement(63574462..63616927)
AA seq 162 aa
MRAPIPEPKPGDLIEIFRPFYRHWAIYVGDGYVVHLAPPSEVAGAGAASVMSALTDKAIV
KKELLYDVAGSDKYQVNNKHDDKYSPLPCSKIIQRAEELVGQEVLYKLTSENCEHFVNEL
RYGVARSDQVRDVIIAASVAGMGLAAMSLIGVMFSRNKRQKQ
NT seq 489 nt   +upstreamnt  +downstreamnt
atgcgtgcgcccattccagagcctaagcctggagacctgattgagatttttcgccctttc
tacagacactgggccatctatgttggcgatggatatgtggttcatctggcccctccaagt
gaggtcgcaggagctggtgcagccagtgtcatgtccgccctgactgacaaggccatcgtg
aagaaggaattgctgtatgatgtggccgggagtgacaagtaccaggtcaacaacaaacat
gatgacaagtactcgccgctgccctgcagcaaaatcatccagcgggcggaggagctggtg
gggcaggaggtgctctacaagctgaccagtgagaactgcgagcactttgtgaatgagctg
cgctatggagtcgcccgcagtgaccaggtcagagatgtcatcatcgctgcaagcgttgca
ggaatgggcttggcagccatgagccttattggagtcatgttctcaagaaacaagcgacaa
aagcaataa

KEGG   Homo sapiens (human): 123745
Entry
123745            CDS       T01001                                 
Symbol
PLA2G4E
Name
(RefSeq) phospholipase A2 group IVE
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00564  Glycerophospholipid metabolism
hsa00565  Ether lipid metabolism
hsa00590  Arachidonic acid metabolism
hsa00591  Linoleic acid metabolism
hsa00592  alpha-Linolenic acid metabolism
hsa01100  Metabolic pathways
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04217  Necroptosis
hsa04270  Vascular smooth muscle contraction
hsa04370  VEGF signaling pathway
hsa04611  Platelet activation
hsa04664  Fc epsilon RI signaling pathway
hsa04666  Fc gamma R-mediated phagocytosis
hsa04724  Glutamatergic synapse
hsa04726  Serotonergic synapse
hsa04730  Long-term depression
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04912  GnRH signaling pathway
hsa04913  Ovarian steroidogenesis
hsa04921  Oxytocin signaling pathway
hsa05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    123745 (PLA2G4E)
   00565 Ether lipid metabolism
    123745 (PLA2G4E)
   00590 Arachidonic acid metabolism
    123745 (PLA2G4E)
   00591 Linoleic acid metabolism
    123745 (PLA2G4E)
   00592 alpha-Linolenic acid metabolism
    123745 (PLA2G4E)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    123745 (PLA2G4E)
   04014 Ras signaling pathway
    123745 (PLA2G4E)
   04370 VEGF signaling pathway
    123745 (PLA2G4E)
   04072 Phospholipase D signaling pathway
    123745 (PLA2G4E)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    123745 (PLA2G4E)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    123745 (PLA2G4E)
   04664 Fc epsilon RI signaling pathway
    123745 (PLA2G4E)
   04666 Fc gamma R-mediated phagocytosis
    123745 (PLA2G4E)
  09152 Endocrine system
   04912 GnRH signaling pathway
    123745 (PLA2G4E)
   04913 Ovarian steroidogenesis
    123745 (PLA2G4E)
   04921 Oxytocin signaling pathway
    123745 (PLA2G4E)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    123745 (PLA2G4E)
  09156 Nervous system
   04724 Glutamatergic synapse
    123745 (PLA2G4E)
   04726 Serotonergic synapse
    123745 (PLA2G4E)
   04730 Long-term depression
    123745 (PLA2G4E)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    123745 (PLA2G4E)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    123745 (PLA2G4E)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     123745 (PLA2G4E)
SSDB
Motif
Pfam: PLA2_B cPLA2_C2 C2
Other DBs
NCBI-GeneID: 123745
NCBI-ProteinID: NP_001193599
HGNC: 24791
Ensembl: ENSG00000188089
Pharos: Q3MJ16(Tdark)
UniProt: Q3MJ16
LinkDB
Position
15:complement(41981582..42050703)
AA seq 868 aa
MSLQASEGCPGLGTNVFVPQSPQTDEEGSRSGRSFSEFEDTQDLDTPGLPPFCPMAPWGS
EEGLSPCHLLTVRVIRMKNVRQADMLSQTDCFVSLWLPTASQKKLRTRTISNCPNPEWNE
SFNFQIQSRVKNVLELSVCDEDTVTPDDHLLTVLYDLTKLCFRKKTHVKFPLNPQGMEEL
EVEFLLEESPSPPETLVTNGVLVSRQVSCLEVHAQSRRRRKREKMKDLLVMVNESFENTQ
RVRPCLEPCCPTSACFQTAACFHYPKYFQSQVHVEVPKSHWSCGLCCRSRKKGPISQPLD
CLSDGQVMTLPVGESYELHMKSTPCPETLDVRLGFSLCPAELEFLQKRKVVVAKALKQVL
QLEEDLQEDEVPLIAIMATGGGTRSMTSMYGHLLGLQKLNLLDCASYITGLSGATWTMAT
LYRDPDWSSKNLEPAIFEARRHVVKDKLPSLFPDQLRKFQEELRQRSQEGYRVTFTDFWG
LLIETCLGDERNECKLSDQRAALSCGQNPLPIYLTINVKDDVSNQDFREWFEFSPYEVGL
QKYGAFIPSELFGSEFFMGRLVKRIPESRICYMLGLWSSIFSLNLLDAWNLSHTSEEFFH
RWTREKVQDIEDEPILPEIPKCDANILETTVVIPGSWLSNSFREILTHRSFVSEFHNFLS
GLQLHTNYLQNGQFSRWKDTVLDGFPNQLTESANHLCLLDTAFFVNSSYPPLLRPERKAD
LIIHLNYCAGSQTKPLKQTCEYCTVQNIPFPKYELPDENENLKECYLMENPQEPDAPIVT
FFPLINDTFRKYKAPGVERSPEELEQGQVDIYGPKTPYATKELTYTEATFDKLVKLSEYN
ILNNKDTLLQALRLAVEKKKRLKGQCPS
NT seq 2607 nt   +upstreamnt  +downstreamnt
atgagtctccaggcctcggaaggctgtcctggcctgggaactaatgtgtttgtcccacag
agcccacaaacggatgaagaaggcagcaggtcaggaagaagtttcagtgagttcgaggat
acacaggacctggacactcctggtctcccacctttctgtcctatggctccttggggctct
gaggaggggctgtctccatgccacctgttgacagtgagggtcatccggatgaaaaatgtc
cggcaggctgatatgctgagccagacagactgttttgtgagcctctggctgcccaccgcc
tctcagaagaagctgaggacaaggaccatctccaactgcccaaatccagagtggaatgaa
agcttcaacttccagatccagagccgagtgaagaacgtgctagagttgagtgtctgtgat
gaagacacagtgacaccagatgaccatctcctgacagttctctatgacctcaccaagctc
tgtttccgaaagaaaacccacgtgaagtttccactcaacccgcagggcatggaagagctg
gaggtggagttcctgctggaggagagtccctctccacctgagaccctcgtcaccaatggc
gtgctggtgtctcgacaagtctcctgcctggaggttcatgcacaatccaggaggcggagg
aagagggagaaaatgaaggacctcctggtgatggtgaacgaatcctttgagaacacccag
cgtgtccggccctgcttggaaccctgctgcccaacctctgcctgcttccaaaccgctgcc
tgcttccactaccccaagtacttccagtcccaggtgcacgtggaagtgcccaagagtcac
tggagctgtgggctttgctgccgctctcgcaagaagggccccatcagccagcccctcgac
tgcctttccgatggtcaggtgatgaccctgcctgtgggtgagagttatgaattacacatg
aagtctacaccctgccctgagacactggacgtgcggctgggcttcagcctgtgcccagca
gagctggagtttctgcagaagcggaaggtcgtggtggccaaggccctgaagcaggtgctg
cagctggaggaagacctgcaggaggacgaggtgccgctgatagccatcatggccactggg
ggtggaacaagatccatgacctccatgtatggccacctgctggggctgcagaagctgaac
ctcctggactgtgccagctacatcaccggtctatcaggggccacctggaccatggctacc
ttgtaccgtgaccctgactggtcctccaaaaacttggagcctgctatctttgaggctcgg
agacatgtggtaaaggacaagctaccctccctgttcccagaccagctccgcaaattccag
gaggagctccggcagcgcagccaggaaggctacagggtcacctttacagacttctggggc
ctgctgatagagacctgcctgggggacgagagaaatgaatgcaaactgtcagatcagcgt
gctgctttgagctgcggccagaaccccctgcccatctacctcaccatcaatgtcaaggat
gatgtaagcaaccaggacttcagagagtggttcgagttctccccctacgaggtgggcctg
cagaagtatggggccttcatcccctccgagctcttcggctccgagttcttcatggggcgg
ctggtgaagaggatcccggagtctcgaatctgctacatgctaggcctgtggagcagcatc
ttctccctgaacctgctggatgcctggaacctgtcacacacctcggaggagtttttccac
aggtggacaagggagaaagtgcaggacatcgaagacgagccgatcctgcctgaaatcccc
aaatgtgatgctaacatcctggagaccacggtagtgatcccagggtcatggctgtccaat
tctttccgagaaatccttacccatcggtccttcgtgtctgagtttcacaacttcctgtct
gggctgcagctgcacaccaactacctccagaatggccagttctctaggtggaaagacaca
gtgctagatggtttcccaaaccagctgaccgagtccgcgaaccacctgtgcctgctggac
actgcgttctttgtcaactccagctacccgcccctcctcaggccagagcgaaaagccgac
ctcatcatccacctcaactactgtgctgggtcccagacaaagcccctgaaacaaacctgt
gagtactgcactgtgcagaacatccccttccccaaatacgagctgccagatgagaatgaa
aatctcaaggaatgctacctgatggagaacccccaggaacccgatgcccccatcgtgact
ttcttcccactcatcaatgacactttccgaaaatacaaggcaccaggtgtagagcgaagc
cctgaggagctggagcagggccaggtggacatttatggtcccaaaactccctatgccacc
aaggagctgacatacacagaggccacctttgacaagctggtgaaactctcagagtataac
atcctgaataataaggacactctcctccaggctctgcggctcgcagtggagaagaagaag
cgcctgaagggccagtgtccctcctag

KEGG   Homo sapiens (human): 151056
Entry
151056            CDS       T01001                                 
Symbol
PLB1, PLB, PLB/LIP
Name
(RefSeq) phospholipase B1
  KO
K14621  phospholipase B1, membrane-associated [EC:3.1.1.4 3.1.1.5]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00564  Glycerophospholipid metabolism
hsa00565  Ether lipid metabolism
hsa00590  Arachidonic acid metabolism
hsa00591  Linoleic acid metabolism
hsa00592  alpha-Linolenic acid metabolism
hsa01100  Metabolic pathways
hsa04977  Vitamin digestion and absorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    151056 (PLB1)
   00565 Ether lipid metabolism
    151056 (PLB1)
   00590 Arachidonic acid metabolism
    151056 (PLB1)
   00591 Linoleic acid metabolism
    151056 (PLB1)
   00592 alpha-Linolenic acid metabolism
    151056 (PLB1)
 09150 Organismal Systems
  09154 Digestive system
   04977 Vitamin digestion and absorption
    151056 (PLB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    151056 (PLB1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     151056 (PLB1)
    3.1.1.5  lysophospholipase
     151056 (PLB1)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    151056 (PLB1)
SSDB
Motif
Pfam: Lipase_GDSL Lipase_GDSL_2
Other DBs
NCBI-GeneID: 151056
NCBI-ProteinID: NP_694566
OMIM: 610179
HGNC: 30041
Ensembl: ENSG00000163803
Pharos: Q6P1J6(Tdark)
UniProt: Q6P1J6 B2RWP8
LinkDB
Position
2:28496060..28644142
AA seq 1458 aa
MGLRPGIFLLELLLLLGQGTPQIHTSPRKSTLEGQLWPETLKNSPFPCNPNKLGVNMPSK
SVHSLKPSDIKFVAAIGNLEIPPDPGTGDLEKQDWTERPQQVCMGVMTVLSDIIRYFSPS
VPMPVCHTGKRVIPHDGAEDLWIQAQELVRNMKENLQLDFQFDWKLINVFFSNASQCYLC
PSAQQNGLAAGGVDELMGVLDYLQQEVPRAFVNLVDLSEVAEVSRQYHGTWLSPAPEPCN
CSEETTRLAKVVMQWSYQEAWNSLLASSRYSEQESFTVVFQPFFYETTPSLHSEDPRLQD
STTLAWHLWNRMMEPAGEKDEPLSVKHGRPMKCPSQESPYLFSYRNSNYLTRLQKPQDKL
EVREGAEIRCPDKDPSDTVPTSVHRLKPADINVIGALGDSLTAGNGAGSTPGNVLDVLTQ
YRGLSWSVGGDENIGTVTTLANILREFNPSLKGFSVGTGKETSPNAFLNQAVAGGRAEDL
PVQARRLVDLMKNDTRIHFQEDWKIITLFIGGNDLCDFCNDLVHYSPQNFTDNIGKALDI
LHAEVPRAFVNLVTVLEIVNLRELYQEKKVYCPRMILRSLCPCVLKFDDNSTELATLIEF
NKKFQEKTHQLIESGRYDTREDFTVVVQPFFENVDMPKTSEGLPDNSFFAPDCFHFSSKS
HSRAASALWNNMLEPVGQKTTRHKFENKINITCPNQVQPFLRTYKNSMQGHGTWLPCRDR
APSALHPTSVHALRPADIQVVAALGDSLTAGNGIGSKPDDLPDVTTQYRGLSYSAGGDGS
LENVTTLPNILREFNRNLTGYAVGTGDANDTNAFLNQAVPGAKAEDLMSQVQTLMQKMKD
DHRVNFHEDWKVITVLIGGSDLCDYCTDSNLYSAANFVHHLRNALDVLHREVPRVLVNLV
DFLNPTIMRQVFLGNPDKCPVQQASVLCNCVLTLRENSQELARLEAFSRAYRSSMRELVG
SGRYDTQEDFSVVLQPFFQNIQLPVLADGLPDTSFFAPDCIHPNQKFHSQLARALWTNML
EPLGSKTETLDLRAEMPITCPTQNEPFLRTPRNSNYTYPIKPAIENWGSDFLCTEWKASN
SVPTSVHQLRPADIKVVAALGDSLTTAVGARPNNSSDLPTSWRGLSWSIGGDGNLETHTT
LPNILKKFNPYLLGFSTSTWEGTAGLNVAAEGARARDMPAQAWDLVERMKNSPDINLEKD
WKLVTLFIGVNDLCHYCENPEAHLATEYVQHIQQALDILSEELPRAFVNVVEVMELASLY
QGQGGKCAMLAAQNNCTCLRHSQSSLEKQELKKVNWNLQHGISSFSYWHQYTQREDFAVV
VQPFFQNTLTPLNERGDTDLTFFSEDCFHFSDRGHAEMAIALWNNMLEPVGRKTTSNNFT
HSRAKLKCPSPESPYLYTLRNSRLLPDQAEEAPEVLYWAVPVAAGVGLVVGIIGTVVWRC
RRGGRREDPPMSLRTVAL
NT seq 4377 nt   +upstreamnt  +downstreamnt
atggggctgcggccaggcattttcctcctggagctgctgctgcttctggggcaagggacc
cctcagatccatacctctcctagaaagagtacattggaagggcagctatggccagagacc
ctgaagaattctccattcccatgcaacccaaataaattaggagtgaatatgccttctaaa
tcagttcactctctgaagccttctgatattaaatttgtggcagccattggcaatctggaa
attcctccagacccagggacgggcgatctggagaagcaagactggactgaaaggccacag
caggtgtgcatgggagtgatgacagtcctttcagacatcatcagatatttcagtccttct
gttccaatgcctgtgtgccacactggaaagagagtcataccccacgatggtgctgaagac
ttgtggattcaggctcaagaactggtgagaaacatgaaagagaacctgcaacttgacttt
caatttgactggaagctcatcaatgtgttcttcagtaatgcaagccagtgttacctgtgc
ccctctgctcaacagaatgggcttgcggcgggcggcgtggatgagctgatgggggtgctg
gactacctgcagcaggaggtccccagagcatttgtaaacctggtggacctctctgaggtt
gcagaggtctctcgtcagtatcacggcacttggctcagccctgcaccagagccctgtaat
tgctcagaggagaccacccggctggccaaggtggtgatgcagtggtcttatcaggaagcc
tggaacagcctcctggcctccagcaggtacagtgagcaggagtccttcaccgtggttttc
cagcctttcttctatgagaccaccccatctctacactcggaggacccccgactccaggat
tctaccacgctggcctggcatctctggaataggatgatggagccagcaggagagaaagat
gagccattgagtgtaaaacacgggaggccaatgaagtgtccctctcaggagagcccctat
ctgttcagctacagaaacagcaactacctgaccagactgcagaaaccccaagacaagctt
gaggtaagagaaggagcggaaatcagatgtcctgacaaagacccctccgatacggttccc
acctcagttcataggctgaagccggctgacatcaacgtaattggagccctgggtgactct
ctcacggcaggcaatggggccgggtccacacctgggaacgtcttggacgtcttgactcag
taccgaggcctgtcctggagcgtcggcggagatgagaacatcggcaccgttaccaccctg
gcgaacatcctccgggaattcaacccttccctgaagggcttctctgttggcactgggaaa
gaaaccagtcctaatgccttcttaaaccaggctgtggcaggaggccgagctgaggatcta
cctgtccaggccaggaggctggtggacctgatgaagaatgacacgaggatacactttcag
gaagactggaagataataaccctgtttataggcggcaatgacctctgtgatttctgcaat
gatctggtccactattctccccagaacttcacagacaacattggaaaggccctggacatc
ctccatgctgaggttcctcgggcatttgtgaacctggtgacggtgcttgagatcgtcaac
ctgagggagctgtaccaggagaaaaaagtctactgcccaaggatgatcctcaggtctctg
tgtccctgtgtcctgaagtttgatgataactcaacagaacttgctaccctcatcgaattc
aacaagaagtttcaggagaagacccaccaactgattgagagtgggcgatatgacacaagg
gaagattttactgtggttgtgcagccgttctttgaaaacgtggacatgccaaagacctcg
gaaggattgcctgacaactctttcttcgctcctgactgtttccacttcagcagcaagtct
cactcccgagcagccagtgctctctggaacaatatgctggagcctgttggccagaagacg
actcgtcataagtttgaaaacaagatcaatatcacatgtccgaaccaggtccagccgttt
ctgaggacctacaagaacagcatgcagggtcatgggacctggctgccatgcagggacaga
gccccttctgccttgcaccctacctcagtgcatgccctgagacctgcagacatccaagtt
gtggctgctctgggggattctctgaccgctggcaatggaattggctccaaaccagacgac
ctccccgatgtcaccacacagtatcggggactgtcatacagtgcaggaggggacggctcc
ctggagaatgtgaccaccttacctaatatccttcgggagtttaacagaaacctcacaggc
tacgccgtgggcacgggtgatgccaatgacacgaatgcattcctcaatcaagctgttccc
ggagcaaaggctgaggatcttatgagccaagtccaaactctgatgcagaagatgaaagat
gatcatagagtaaatttccatgaagactggaaggtcatcacagtgctgatcggaggcagc
gatttatgtgactactgcacagattcgaatctgtattctgcagccaactttgttcaccat
ctccgcaatgccttggacgtcctgcatagagaggtgcccagagtcctggtcaacctcgtg
gacttcctgaaccccactatcatgcggcaggtgttcctgggaaacccagacaagtgccca
gtgcagcaggccagcgttttgtgtaactgcgttctgaccctgcgggagaactcccaagag
ctagccaggctggaggccttcagccgagcctaccggagcagcatgcgcgagctggtgggg
tcaggccgctatgacacgcaggaggacttctctgtggtgctgcagcccttcttccagaac
atccagctccctgtcctggcggatgggctcccagatacgtccttctttgccccagactgc
atccacccaaatcagaaattccactcccagctggccagagccctttggaccaatatgctt
gaaccacttggaagcaaaacagagaccctggacctgagagcagagatgcccatcacctgt
cccactcagaatgagcccttcctgagaacccctcggaatagtaactacacgtaccccatc
aagccagccattgagaactggggcagtgacttcctgtgtacagagtggaaggcttccaat
agtgttccaacctctgtccaccagctccgaccagcagacatcaaagtggtggccgccctg
ggtgactctctgactacagcagtgggagctcgaccaaacaactccagtgacctacccaca
tcttggaggggactctcttggagcattggaggggatgggaacttggagactcacaccaca
ctgcccaacattctgaagaagttcaacccttacctccttggcttctctaccagcacctgg
gaggggacagcaggactaaatgtggcagcggaaggggccagagctagggacatgccagcc
caggcctgggacctggtagagcgaatgaaaaacagccccgacatcaacctggagaaagac
tggaagctggtcacactcttcattggggtcaacgacttgtgtcattactgtgagaatccg
gaggcccacttggccacggaatatgttcagcacatccaacaggccctggacatcctctct
gaggagctcccaagggctttcgtcaacgtggtggaggtcatggagctggctagcctgtac
cagggccaaggcgggaaatgtgccatgctggcagctcagaacaactgcacttgcctcaga
cactcgcaaagctccctggagaagcaagaactgaagaaagtgaactggaacctccagcat
ggcatctccagtttctcctactggcaccaatacacacagcgtgaggactttgcggttgtg
gtgcagcctttcttccaaaacacactcaccccactgaacgagagaggggacactgacctc
accttcttctccgaggactgttttcacttctcagaccgcgggcatgccgagatggccatc
gcactctggaacaacatgctggaaccagtgggccgcaagactacctccaacaacttcacc
cacagccgagccaaactcaagtgcccctctcctgagagcccttacctctacaccctgcgg
aacagccgattgctcccagaccaggctgaagaagcccccgaggtgctctactgggctgtc
ccagtggcagcgggagtcggccttgtggtgggcatcatcgggacagtggtctggaggtgc
aggagaggtggccggagggaagatcctccaatgagcctgcgcactgtggccctctag

KEGG   Homo sapiens (human): 255189
Entry
255189            CDS       T01001                                 
Symbol
PLA2G4F, PLA2G4FZ
Name
(RefSeq) phospholipase A2 group IVF
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00564  Glycerophospholipid metabolism
hsa00565  Ether lipid metabolism
hsa00590  Arachidonic acid metabolism
hsa00591  Linoleic acid metabolism
hsa00592  alpha-Linolenic acid metabolism
hsa01100  Metabolic pathways
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04217  Necroptosis
hsa04270  Vascular smooth muscle contraction
hsa04370  VEGF signaling pathway
hsa04611  Platelet activation
hsa04664  Fc epsilon RI signaling pathway
hsa04666  Fc gamma R-mediated phagocytosis
hsa04724  Glutamatergic synapse
hsa04726  Serotonergic synapse
hsa04730  Long-term depression
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04912  GnRH signaling pathway
hsa04913  Ovarian steroidogenesis
hsa04921  Oxytocin signaling pathway
hsa05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    255189 (PLA2G4F)
   00565 Ether lipid metabolism
    255189 (PLA2G4F)
   00590 Arachidonic acid metabolism
    255189 (PLA2G4F)
   00591 Linoleic acid metabolism
    255189 (PLA2G4F)
   00592 alpha-Linolenic acid metabolism
    255189 (PLA2G4F)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    255189 (PLA2G4F)
   04014 Ras signaling pathway
    255189 (PLA2G4F)
   04370 VEGF signaling pathway
    255189 (PLA2G4F)
   04072 Phospholipase D signaling pathway
    255189 (PLA2G4F)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    255189 (PLA2G4F)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    255189 (PLA2G4F)
   04664 Fc epsilon RI signaling pathway
    255189 (PLA2G4F)
   04666 Fc gamma R-mediated phagocytosis
    255189 (PLA2G4F)
  09152 Endocrine system
   04912 GnRH signaling pathway
    255189 (PLA2G4F)
   04913 Ovarian steroidogenesis
    255189 (PLA2G4F)
   04921 Oxytocin signaling pathway
    255189 (PLA2G4F)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    255189 (PLA2G4F)
  09156 Nervous system
   04724 Glutamatergic synapse
    255189 (PLA2G4F)
   04726 Serotonergic synapse
    255189 (PLA2G4F)
   04730 Long-term depression
    255189 (PLA2G4F)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    255189 (PLA2G4F)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    255189 (PLA2G4F)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     255189 (PLA2G4F)
SSDB
Motif
Pfam: PLA2_B cPLA2_C2 C2
Other DBs
NCBI-GeneID: 255189
NCBI-ProteinID: NP_998765
HGNC: 27396
Ensembl: ENSG00000168907
Pharos: Q68DD2(Tdark)
UniProt: Q68DD2 A5PKZ7
LinkDB
Position
15:complement(42139034..42156636)
AA seq 849 aa
MLWALWPRWLADKMLPLLGAVLLQKREKRGPLWRHWRRETYPYYDLQVKVLRATNIRGTD
LLSKADCYVQLWLPTASPSPAQTRIVANCSDPEWNETFHYQIHGAVKNVLELTLYDKDIL
GSDQLSLLLFDLRSLKCGQPHKHTFPLNHQDSQELQVEFVLEKSQVPASEVITNGVLVAH
PCLRIQGTLRGDGTAPREEYGSRQLQLAVPGAYEKPQLLPLQPPTEPGLPPTFTFHVNPV
LSSRLHVELMELLAAVQSGPSAELEAQTSKLGEGGILLSSLPLGQEEQCSVALGEGQEVA
LSMKVEMSSGDLDLRLGFDLSDGEQEFLDRRKQVVSKALQQVLGLSEALDSGQVPVVAVL
GSGGGTRAMSSLYGSLAGLQELGLLDTVTYLSGVSGSTWCISTLYRDPAWSQVALQGPIE
RAQVHVCSSKMGALSTERLQYYTQELGVRERSGHSVSLIDLWGLLVEYLLYQEENPAKLS
DQQEAVRQGQNPYPIYTSVNVRTNLSGEDFAEWCEFTPYEVGFPKYGAYVPTELFGSELF
MGRLLQLQPEPRICYLQGMWGSAFATSLDEIFLKTAGSGLSFLEWYRGSVNITDDCQKPQ
LHNPSRLRTRLLTPQGPFSQAVLDIFTSRFTSAQSFNFTRGLCLHKDYVAGREFVAWKDT
HPDAFPNQLTPMRDCLYLVDGGFAINSPFPLALLPQRAVDLILSFDYSLEAPFEVLKMTE
KYCLDRGIPFPSIEVGPEDMEEARECYLFAKAEDPRSPIVLHFPLVNRTFRTHLAPGVER
QTAEEKAFGDFVINRPDTPYGMMNFTYEPQDFYRLVALSRYNVLNNVETLKCALQLALDR
HQARERAGA
NT seq 2550 nt   +upstreamnt  +downstreamnt
atgctttgggcactctggccaaggtggctggcagacaagatgctgcccctcctgggggca
gtgctgcttcagaagagagagaagaggggccctctgtggaggcactggcggcgggaaacc
tacccatactatgacctccaggtgaaggtgctgagggccacaaacatccggggcacagac
ctgctgtccaaagccgactgctatgtgcaactgtggctgcccacggcgtccccaagccct
gcccagactaggatagtggccaactgcagtgaccccgagtggaatgagaccttccactac
cagatccatggtgctgtgaagaacgtcctggagctcaccctctatgacaaggacatcctg
ggcagcgaccagctctctctgctcctgtttgacctgagaagcctcaagtgtggccaacct
cacaaacacaccttcccactcaaccaccaggattcacaagagctgcaggtggaatttgtt
ctggagaagagccaggtgcctgcatctgaagtcatcaccaacggggttctggtggctcac
ccctgtctgagaatccagggcacgctccggggagatgggacagccccacgggaagagtac
ggctctaggcagctccagctggcagtgcctggagcctacgagaagccacagctcttgccc
ctgcagcctcccacagagccaggcctcccacccacctttaccttccacgtgaacccagtg
ctgagctccaggctacacgtggagctgatggagctgctggcagctgtgcagagtggcccc
agcgcagagttggaggctcagaccagcaagctgggcgaggggggcatcctgctctcctct
ctgcccctaggccaggaggaacagtgttctgtggccctgggggagggccaggaggtggct
ctgagcatgaaggtggaaatgagctccggggacctagacctacgccttggctttgacctc
tctgacggggagcaggagtttctggacaggaggaagcaggtcgtgtccaaggccctgcag
caagtgctgggattgagtgaggctctggacagtggccaggtgcctgtagtggctgtgttg
ggttccgggggtggaacccgagccatgtcttctctgtacggcagcctggcagggttgcag
gagctcggccttctagacactgtgacctacctgagtggggtctctgggtctacctggtgc
atctccacactctacagggacccagcctggtcccaggtggccttgcagggccccattgag
cgtgcccaggttcacgtctgcagcagtaagatgggagctttgtccacggagcggctacag
tactacactcaggaactgggggtccgggagcgcagtggccacagcgtgtccctcatcgac
ctctggggcctccttgttgagtatctcctgtaccaggaggagaaccctgccaagctgtct
gaccaacaggaggcggtccgccagggtcagaacccttaccccatttacaccagtgtcaac
gtccgcaccaacttgagtggggaagattttgcagagtggtgcgagttcacgccctatgag
gttggcttccccaagtacggggcttatgttcccaccgagctcttcggctcagaactcttc
atgggacgattgctgcagctccagcctgaaccccggatctgttacctgcaaggtatgtgg
ggcagcgcctttgccaccagcctggatgagatcttcctaaagaccgccggctcgggcctc
agcttcctggagtggtacagaggcagtgtgaatatcacagacgactgccagaagcctcag
ctgcacaacccctcgaggctgcgaacgaggctcctcaccccacaggggcccttctcccag
gctgtgctggacatattcacctcccgcttcacttccgcccagagctttaacttcacccgg
ggtctctgcttgcacaaggactatgtggctggcagggagttcgtggcctggaaagacaca
cacccggacgccttccccaaccagctcacccccatgcgggactgcctgtacctggtggac
ggaggctttgccatcaactctccgttcccactggctctgctgcctcagagagcagtggac
ctcattctgtcctttgactattccttggaagccccttttgaggtcttgaagatgacagag
aagtactgcctggaccgaggaatccccttccctagcatcgaggtgggccctgaggacatg
gaggaggcccgtgagtgctatctgtttgccaaggctgaggacccccgctcccccattgtg
ctgcacttccccctggttaaccgtaccttccgcacacacctggccccaggtgtggagcga
caaacagctgaggagaaggcctttggggactttgtcatcaacaggccagacaccccctat
ggcatgatgaacttcacctatgagccccaggacttttatcggctggtggccctcagtcga
tacaacgtcctgaacaacgtggagaccttgaagtgcgccctccagctggctctggaccgg
caccaggctcgggagagggcaggggcctga

KEGG   Homo sapiens (human): 26279
Entry
26279             CDS       T01001                                 
Symbol
PLA2G2D, PLA2IID, SPLASH, sPLA2-IID, sPLA2S
Name
(RefSeq) phospholipase A2 group IID
  KO
K01047  secretory phospholipase A2 [EC:3.1.1.4]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00564  Glycerophospholipid metabolism
hsa00565  Ether lipid metabolism
hsa00590  Arachidonic acid metabolism
hsa00591  Linoleic acid metabolism
hsa00592  alpha-Linolenic acid metabolism
hsa01100  Metabolic pathways
hsa04014  Ras signaling pathway
hsa04270  Vascular smooth muscle contraction
hsa04972  Pancreatic secretion
hsa04975  Fat digestion and absorption
Drug target
Varespladib (DG01394): D06283
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    26279 (PLA2G2D)
   00565 Ether lipid metabolism
    26279 (PLA2G2D)
   00590 Arachidonic acid metabolism
    26279 (PLA2G2D)
   00591 Linoleic acid metabolism
    26279 (PLA2G2D)
   00592 alpha-Linolenic acid metabolism
    26279 (PLA2G2D)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    26279 (PLA2G2D)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    26279 (PLA2G2D)
  09154 Digestive system
   04972 Pancreatic secretion
    26279 (PLA2G2D)
   04975 Fat digestion and absorption
    26279 (PLA2G2D)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    26279 (PLA2G2D)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     26279 (PLA2G2D)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation proteins
   Centriole proteins
    26279 (PLA2G2D)
SSDB
Motif
Pfam: Phospholip_A2_1 DUF5460
Other DBs
NCBI-GeneID: 26279
NCBI-ProteinID: NP_036532
OMIM: 605630
HGNC: 9033
Ensembl: ENSG00000117215
Pharos: Q9UNK4(Tchem)
UniProt: Q9UNK4
LinkDB
Position
1:complement(20111939..20119536)
AA seq 145 aa
MELALLCGLVVMAGVIPIQGGILNLNKMVKQVTGKMPILSYWPYGCHCGLGGRGQPKDAT
DWCCQTHDCCYDHLKTQGCSIYKDYYRYNFSQGNIHCSDKGSWCEQQLCACDKEVAFCLK
RNLDTYQKRLRFYWRPHCRGQTPGC
NT seq 438 nt   +upstreamnt  +downstreamnt
atggaacttgcactgctgtgtgggctggtggtgatggctggtgtgattccaatccagggc
gggatcctgaacctgaacaagatggtcaagcaagtgactgggaaaatgcccatcctctcc
tactggccctacggctgtcactgcggactaggtggcagaggccaacccaaagatgccacg
gactggtgctgccagacccatgactgctgctatgaccacctgaagacccaggggtgcagc
atctacaaggactattacagatacaacttttcccaggggaacatccactgctctgacaag
ggaagctggtgtgagcagcagctgtgtgcctgtgacaaggaggtggccttctgcctgaag
cgcaacctggacacctaccagaagcgactgcgtttctactggcggccccactgccggggg
cagacccctgggtgctag

KEGG   Homo sapiens (human): 283748
Entry
283748            CDS       T01001                                 
Symbol
PLA2G4D, cPLA2delta
Name
(RefSeq) phospholipase A2 group IVD
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00564  Glycerophospholipid metabolism
hsa00565  Ether lipid metabolism
hsa00590  Arachidonic acid metabolism
hsa00591  Linoleic acid metabolism
hsa00592  alpha-Linolenic acid metabolism
hsa01100  Metabolic pathways
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04217  Necroptosis
hsa04270  Vascular smooth muscle contraction
hsa04370  VEGF signaling pathway
hsa04611  Platelet activation
hsa04664  Fc epsilon RI signaling pathway
hsa04666  Fc gamma R-mediated phagocytosis
hsa04724  Glutamatergic synapse
hsa04726  Serotonergic synapse
hsa04730  Long-term depression
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04912  GnRH signaling pathway
hsa04913  Ovarian steroidogenesis
hsa04921  Oxytocin signaling pathway
hsa05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    283748 (PLA2G4D)
   00565 Ether lipid metabolism
    283748 (PLA2G4D)
   00590 Arachidonic acid metabolism
    283748 (PLA2G4D)
   00591 Linoleic acid metabolism
    283748 (PLA2G4D)
   00592 alpha-Linolenic acid metabolism
    283748 (PLA2G4D)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    283748 (PLA2G4D)
   04014 Ras signaling pathway
    283748 (PLA2G4D)
   04370 VEGF signaling pathway
    283748 (PLA2G4D)
   04072 Phospholipase D signaling pathway
    283748 (PLA2G4D)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    283748 (PLA2G4D)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    283748 (PLA2G4D)
   04664 Fc epsilon RI signaling pathway
    283748 (PLA2G4D)
   04666 Fc gamma R-mediated phagocytosis
    283748 (PLA2G4D)
  09152 Endocrine system
   04912 GnRH signaling pathway
    283748 (PLA2G4D)
   04913 Ovarian steroidogenesis
    283748 (PLA2G4D)
   04921 Oxytocin signaling pathway
    283748 (PLA2G4D)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    283748 (PLA2G4D)
  09156 Nervous system
   04724 Glutamatergic synapse
    283748 (PLA2G4D)
   04726 Serotonergic synapse
    283748 (PLA2G4D)
   04730 Long-term depression
    283748 (PLA2G4D)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    283748 (PLA2G4D)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    283748 (PLA2G4D)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     283748 (PLA2G4D)
SSDB
Motif
Pfam: cPLA2_C2 PLA2_B C2
Other DBs
NCBI-GeneID: 283748
NCBI-ProteinID: NP_828848
OMIM: 612864
HGNC: 30038
Ensembl: ENSG00000159337
Pharos: Q86XP0(Tdark)
UniProt: Q86XP0
Structure
LinkDB
Position
15:complement(42067009..42094562)
AA seq 818 aa
MESLSPGGPPGHPYQGEASTCWQLTVRVLEARNLRWADLLSEADPYVILQLSTAPGMKFK
TKTLTDTSHPVWNEAFRFLIQSQVKNVLELSIYDEDSVTEDDICFKVLYDISEVLPGKLL
RKTFSQSPQGEEELDVEFLMEETSDRPENLITNKVIVARELSCLDVHLDSTGSTAVVADQ
DKLELELVLKGSYEDTQTSFLGTASAFRFHYMAALETELSGRLRSSRSNGWNGDNSAGYL
TVPLRPLTIGKEVTMDVPAPNAPGVRLQLKAEGCPEELAVHLGFNLCAEEQAFLSRRKQV
VAKALKQALQLDRDLQEDEVPVVGIMATGGGARAMTSLYGHLLALQKLGLLDCVTYFSGI
SGSTWTMAHLYGDPEWSQRDLEGPIRYAREHLAKSKLEVFSPERLASYRRELELRAEQGH
PTTFVDLWALVLESMLHGQVMDQKLSGQRAALERGQNPLPLYLSLNVKENNLETLDFKEW
VEFSPYEVGFLKYGAFVPPELFGSEFFMGRLMRRIPEPRICFLEAIWSNIFSLNLLDAWY
DLTSSGESWKQHIKDKTRSLEKEPLTTSGTSSRLEASWLQPGTALAQAFKGFLTGRPLHQ
RSPNFLQGLQLHQDYCSHKDFSTWADYQLDSMPSQLTPKEPRLCLVDAAYFINTSSPSMF
RPGRRLDLILSFDYSLSAPFEALQQTELYCRARGLPFPRVEPSPQDQHQPRECHLFSDPA
CPEAPILLHFPLVNASFKDHSAPGVQRSPAELQGGQVDLTGATCPYTLSNMTYKEEDFER
LLRLSDYNVQTSQGAILQALRTALKHRTLEARPPRAQT
NT seq 2457 nt   +upstreamnt  +downstreamnt
atggagagcctgtcacctgggggaccacctggccacccttaccagggggaggcctctacc
tgctggcagctcacagtgagggtcctggaggcgcggaacctgcgctgggctgacctgttg
agtgaggccgacccttacgtgatcctacagctgtcgaccgcacctggaatgaagtttaag
accaagacgctcaccgacaccagtcatcctgtgtggaatgaggccttccgtttccttatc
caaagtcaggtcaagaatgttctggagcttagcatctatgatgaggactcagtcacggag
gatgacatctgcttcaaggttctctatgacatctcagaagtcctccctggcaagctgctc
cggaaaaccttctcccagagtccccagggagaggaggagctggatgtggagttcctgatg
gaagaaacgtcagatcgcccagaaaacctcatcaccaacaaagtcattgtggcccgagag
ctgtcatgcctggatgtgcatctggacagcacagggagcaccgctgtggttgcagatcag
gacaagctggagctggagctggtgctgaaggggtcctatgaggacacacagacatccttc
ctgggcacagcctctgccttccgcttccactacatggcagccctagagacagagctgagc
gggcgcctgaggagctccagaagcaatggctggaatggggacaactcagctgggtacctc
actgtgcccctgaggcccttgaccattgggaaggaggtgactatggatgttcctgctcca
aatgccccaggagtgaggctgcagctcaaggcagagggctgccctgaggagctggccgtg
cacctgggcttcaatctctgtgcagaggagcaggccttcctgagcaggaggaagcaggtg
gtggccaaggccctgaagcaggccctgcagctggacagagacctgcaggaggatgaggta
cccgttgtgggcatcatggccacaggaggaggtgcccgggccatgacctcactctacggc
cacctattggccttgcagaagctgggcctcctagactgtgtgacctacttcagtggcatc
tctggctctacgtggacaatggcccacctgtacggggaccctgagtggtcgcagagggac
ctggagggacctatcagatacgcccgggagcacctggccaagagcaagctggaggtcttt
tccccagagcgcctggcgagctaccgccgggagctggagctgcgggctgagcagggccac
cccacgacctttgtggacctgtgggcgctagtgctggagtccatgctgcacggccaggtg
atggatcagaagctgtcaggacagagagccgccctggaacggggtcagaaccctctgccc
ctctacttgagcctcaatgtcaaagagaacaatctggagacactggacttcaaggagtgg
gttgagttctccccctatgaggtcggtttcctgaagtacggggccttcgtccctcctgag
ctcttcggctccgagttcttcatgggacggctgatgaggaggatcccggagccccggatc
tgctttctggaagccatctggagcaacattttctccctgaacctgctggatgcctggtat
gacctcaccagttctggggagtcctggaaacagcacatcaaggacaagaccaggagctta
gagaaggagcccctgaccacctcggggacctcctcgcggctggaggcctcgtggctgcag
ccaggcacggcgctggcccaggcatttaaaggcttcctgacaggcaggcccctccaccag
cgcagccccaacttcctccagggcctccagctgcaccaggactactgtagccacaaagac
ttctccacctgggcagactaccagcttgactccatgcccagccagctgacccccaaggag
ccccggctctgcctggtggacgccgcctacttcatcaacaccagctctccctccatgttc
cggccaggccgcaggctggacctcatcctctccttcgactactccctatctgcgcccttc
gaggcactgcagcagacggagctgtactgccgggcccgggggctgcccttcccccgggtg
gaacccagccctcaggaccagcaccagccaagggaatgccacctcttctcagaccccgcc
tgccccgaggccccgatcctgctgcacttcccgctggtcaatgcctccttcaaggaccac
tcagcccccggtgtccagcgcagccccgcagagctccagggtggccaagtggatctcacc
ggggccacctgcccctacaccctgtccaacatgacctacaaggaggaagacttcgagcgc
ctgctgcggctcagtgactacaacgtgcagaccagccagggtgccatcctgcaggccctg
aggaccgcgctgaagcaccggactctagaggcgaggcctccaagggcacagacctga

KEGG   Homo sapiens (human): 30814
Entry
30814             CDS       T01001                                 
Symbol
PLA2G2E, GIIE_sPLA2, sPLA2-IIE
Name
(RefSeq) phospholipase A2 group IIE
  KO
K01047  secretory phospholipase A2 [EC:3.1.1.4]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00564  Glycerophospholipid metabolism
hsa00565  Ether lipid metabolism
hsa00590  Arachidonic acid metabolism
hsa00591  Linoleic acid metabolism
hsa00592  alpha-Linolenic acid metabolism
hsa01100  Metabolic pathways
hsa04014  Ras signaling pathway
hsa04270  Vascular smooth muscle contraction
hsa04972  Pancreatic secretion
hsa04975  Fat digestion and absorption
Drug target
Varespladib (DG01394): D06283
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    30814 (PLA2G2E)
   00565 Ether lipid metabolism
    30814 (PLA2G2E)
   00590 Arachidonic acid metabolism
    30814 (PLA2G2E)
   00591 Linoleic acid metabolism
    30814 (PLA2G2E)
   00592 alpha-Linolenic acid metabolism
    30814 (PLA2G2E)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    30814 (PLA2G2E)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    30814 (PLA2G2E)
  09154 Digestive system
   04972 Pancreatic secretion
    30814 (PLA2G2E)
   04975 Fat digestion and absorption
    30814 (PLA2G2E)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    30814 (PLA2G2E)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     30814 (PLA2G2E)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation proteins
   Centriole proteins
    30814 (PLA2G2E)
SSDB
Motif
Pfam: Phospholip_A2_1
Other DBs
NCBI-GeneID: 30814
NCBI-ProteinID: NP_055404
OMIM: 618320
HGNC: 13414
Ensembl: ENSG00000188784
Pharos: Q9NZK7(Tchem)
UniProt: Q9NZK7
Structure
LinkDB
Position
1:complement(19920009..19923617)
AA seq 142 aa
MKSPHVLVFLCLLVALVTGNLVQFGVMIEKMTGKSALQYNDYGCYCGIGGSHWPVDQTDW
CCHAHDCCYGRLEKLGCEPKLEKYLFSVSERGIFCAGRTTCQRLTCECDKRAALCFRRNL
GTYNRKYAHYPNKLCTGPTPPC
NT seq 429 nt   +upstreamnt  +downstreamnt
atgaaatctccccacgtgctggtgttcctttgcctcctggtggctctggtcaccgggaac
ctggttcagtttggggtgatgatcgagaagatgacaggcaagtccgccctgcagtacaac
gactatggctgttactgcggcatcggtggctcccactggccggtggaccagactgactgg
tgctgccacgcccacgactgctgctacgggcgtctggagaagctgggctgtgagcccaaa
ctggaaaagtatcttttctctgtcagcgaacgtggcattttctgcgccggcaggaccacc
tgccagcggctgacctgcgagtgtgacaagagggctgccctctgctttcgccgcaacctg
ggcacctacaaccgcaaatatgcccattatcccaacaagctgtgcaccgggcccaccccg
ccctgctga

KEGG   Homo sapiens (human): 391013
Entry
391013            CDS       T01001                                 
Symbol
PLA2G2C, UBXN10-AS1
Name
(RefSeq) phospholipase A2 group IIC
  KO
K01047  secretory phospholipase A2 [EC:3.1.1.4]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00564  Glycerophospholipid metabolism
hsa00565  Ether lipid metabolism
hsa00590  Arachidonic acid metabolism
hsa00591  Linoleic acid metabolism
hsa00592  alpha-Linolenic acid metabolism
hsa01100  Metabolic pathways
hsa04014  Ras signaling pathway
hsa04270  Vascular smooth muscle contraction
hsa04972  Pancreatic secretion
hsa04975  Fat digestion and absorption
Drug target
Varespladib (DG01394): D06283
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    391013 (PLA2G2C)
   00565 Ether lipid metabolism
    391013 (PLA2G2C)
   00590 Arachidonic acid metabolism
    391013 (PLA2G2C)
   00591 Linoleic acid metabolism
    391013 (PLA2G2C)
   00592 alpha-Linolenic acid metabolism
    391013 (PLA2G2C)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    391013 (PLA2G2C)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    391013 (PLA2G2C)
  09154 Digestive system
   04972 Pancreatic secretion
    391013 (PLA2G2C)
   04975 Fat digestion and absorption
    391013 (PLA2G2C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    391013 (PLA2G2C)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     391013 (PLA2G2C)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation proteins
   Centriole proteins
    391013 (PLA2G2C)
SSDB
Motif
Pfam: Phospholip_A2_1
Other DBs
NCBI-GeneID: 391013
NCBI-ProteinID: NP_001354898
HGNC: 9032
Ensembl: ENSG00000187980
UniProt: Q5R387
LinkDB
Position
1:complement(20163055..20186518)
AA seq 149 aa
MKVIAILTLLLFCSPTHSSFWQFQRRVKHITGRSAFFSYYGYGCYCGLGDKGIPVDDTDR
HSPSSPSPYEKLKEFSCQPVLNSYQFHIVNGAVVCGCTLGPGASCHCRLKACECDKQSVH
CFKESLPTYEKNFKQFSSQPRCGRHKPWC
NT seq 450 nt   +upstreamnt  +downstreamnt
atgaaggtcattgccatcctcaccctcctcctcttctgctcccccacccacagcagtttc
tggcagtttcagaggagggtcaaacacatcacggggcgaagtgccttcttctcatattac
ggatatggctgctactgtgggcttggggataaagggatccccgtggatgacactgacagg
cacagcccctcatctccctctccctacgagaagctgaaggagttcagctgccagcctgtg
ttgaacagctaccagttccacatcgtcaatggcgcagtggtttgtggatgcacccttggt
cctggtgccagctgccactgcaggctgaaggcctgtgagtgtgacaagcaatccgtgcac
tgcttcaaagagagcctgcccacctatgagaaaaacttcaagcagttctccagccagccc
aggtgtggcagacataagccctggtgctag

KEGG   Homo sapiens (human): 50487
Entry
50487             CDS       T01001                                 
Symbol
PLA2G3, GIII-SPLA2, SPLA2III, sPLA2-III
Name
(RefSeq) phospholipase A2 group III
  KO
K01047  secretory phospholipase A2 [EC:3.1.1.4]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00564  Glycerophospholipid metabolism
hsa00565  Ether lipid metabolism
hsa00590  Arachidonic acid metabolism
hsa00591  Linoleic acid metabolism
hsa00592  alpha-Linolenic acid metabolism
hsa01100  Metabolic pathways
hsa04014  Ras signaling pathway
hsa04270  Vascular smooth muscle contraction
hsa04972  Pancreatic secretion
hsa04975  Fat digestion and absorption
Drug target
Varespladib (DG01394): D06283
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    50487 (PLA2G3)
   00565 Ether lipid metabolism
    50487 (PLA2G3)
   00590 Arachidonic acid metabolism
    50487 (PLA2G3)
   00591 Linoleic acid metabolism
    50487 (PLA2G3)
   00592 alpha-Linolenic acid metabolism
    50487 (PLA2G3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    50487 (PLA2G3)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    50487 (PLA2G3)
  09154 Digestive system
   04972 Pancreatic secretion
    50487 (PLA2G3)
   04975 Fat digestion and absorption
    50487 (PLA2G3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    50487 (PLA2G3)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     50487 (PLA2G3)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation proteins
   Centriole proteins
    50487 (PLA2G3)
SSDB
Motif
Pfam: Phospholip_A2_2 Chromadorea_ALT
Other DBs
NCBI-GeneID: 50487
NCBI-ProteinID: NP_056530
OMIM: 611651
HGNC: 17934
Ensembl: ENSG00000100078
Pharos: Q9NZ20(Tbio)
UniProt: Q9NZ20
LinkDB
Position
22:complement(31134807..31140508)
AA seq 509 aa
MGVQAGLFGMLGFLGVALGGSPALRWYRTSCHLTKAVPGNPLGYLSFLAKDAQGLALIHA
RWDAHRRLQSCSWEDEPELTAAYGALCAHETAWGSFIHTPGPELQRALATLQSQWEACRA
LEESPAGARKKRAAGQSGVPGGGHQREKRGWTMPGTLWCGVGDSAGNSSELGVFQGPDLC
CREHDRCPQNISPLQYNYGIRNYRFHTISHCDCDTRFQQCLQNQHDSISDIVGVAFFNVL
EIPCFVLEEQEACVAWYWWGGCRMYGTVPLARLQPRTFYNASWSSRATSPTPSSRSPAPP
KPRQKQHLRKGPPHQKGSKRPSKANTTALQDPMVSPRLDVAPTGLQGPQGGLKPQGARWV
CRSFRRHLDQCEHQIGPREIEFQLLNSAQEPLFHCNCTRRLARFLRLHSPPEVTNMLWEL
LGTTCFKLAPPLDCVEGKNCSRDPRAIRVSARHLRRLQQRRHQLQDKGTDERQPWPSEPL
RGPMSFYNQCLQLTQAARRPDRQQKSWSQ
NT seq 1530 nt   +upstreamnt  +downstreamnt
atgggggttcaggcagggctgtttgggatgctgggcttcctgggggtggccctggggggc
tcccctgccctccgctggtacaggacctcctgccacttgaccaaggccgtccctggcaac
ccactggggtacctgagcttcctggccaaggatgctcagggactggccctgatccatgcc
cgctgggatgcgcataggaggctgcagtcatgtagctgggaggatgagccggagctcacc
gcagcctacggtgctctctgtgctcatgagactgcctggggctccttcatccacaccccc
ggacccgagctgcagagagcactggccactcttcagagtcagtgggaggcatgccgagcg
cttgaggagagtccagcaggggccaggaagaagcgagcagcagggcagagtggagtccct
ggtggagggcaccagcgagagaagagaggatggaccatgcctggcacactgtggtgtgga
gttggagattctgctgggaactcctcggagctgggggtcttccagggacctgatctctgt
tgccgggaacatgaccgctgcccacagaacatctcacccttgcagtacaactatggcatc
cgaaactaccgattccacaccatctcccactgtgactgtgacaccaggtttcagcaatgc
ctacagaatcagcacgactccatctcggacatcgtgggcgtggccttcttcaacgtgctg
gagatcccctgctttgtgctggaggagcaggaggcgtgtgtggcgtggtactggtggggc
gggtgtaggatgtacggcacagtgcccctcgctcgcctgcagcccaggaccttctacaat
gcctcctggagctcccgggccacctccccaactcccagctcccggagcccagcccctccc
aagcctcgacagaagcagcaccttcggaaggggccaccacatcagaaagggtccaagcgc
cccagcaaagccaacaccacagccctccaggaccctatggtctctcccaggcttgatgtg
gcccccacaggcctccagggcccacagggtggcctaaaacctcagggtgcccgctgggtc
tgccgcagcttccgccgccacctggaccagtgtgagcaccagattgggccccgggaaatc
gagttccagctgctcaacagcgcccaagagcccctcttccactgcaactgcacgcgccgt
ctggcacgcttcctgaggctccacagcccacccgaggttaccaacatgctttgggagctg
ctgggcacaacctgcttcaagctggcccctccactggactgtgtggaaggcaaaaactgt
tccagagaccctagggccatcagggtgtcagcccggcacttgcggaggcttcagcagagg
cgacaccagctccaggataaaggcacagatgagaggcagccatggccttcagagcccctg
agaggccccatgtcattctacaaccagtgcctgcagctaacccaggcagccaggagaccc
gacaggcagcagaagtcctggagccagtga

DBGET integrated database retrieval system