KEGG   Homo sapiens (human): 10019
Entry
10019             CDS       T01001                                 
Symbol
SH2B3, IDDM20, LNK
Name
(RefSeq) SH2B adaptor protein 3
  KO
K12459  SH2B adaptor protein 1/3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04722  Neurotrophin signaling pathway
Disease
H00236  Congenital polycythemia
H00408  Type 1 diabetes mellitus
H01605  Myelofibrosis
H01612  Essential thrombocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    10019 (SH2B3)
SSDB
Motif
Pfam: Phe_ZIP SH2 PH
Other DBs
NCBI-GeneID: 10019
NCBI-ProteinID: NP_005466
OMIM: 605093
HGNC: 29605
Ensembl: ENSG00000111252
Pharos: Q9UQQ2(Tbio)
UniProt: Q9UQQ2 Q59H48
LinkDB
Position
12:111404730..111451623
AA seq 575 aa
MNGPALQPSSPSSAPSASPAAAPRGWSEFCELHAVAAARELARQYWLFAREHPQHAPLRA
ELVSLQFTDLFQRYFCREVRDGRAPGRDYRDTGRGPPAKAEASPEPGPGPAAPGLPKARS
SEELAPPRPPGPCSFQHFRRSLRHIFRRRSAGELPAAHTAAAPGTPGEAAETPARPGLAK
KFLPWSLAREPPPEALKEAVLRYSLADEASMDSGARWQRGRLALRRAPGPDGPDRVLELF
DPPKSSRPKLQAACSSIQEVRWCTRLEMPDNLYTFVLKVKDRTDIIFEVGDEQQLNSWMA
ELSECTGRGLESTEAEMHIPSALEPSTSSSPRGSTDSLNQGASPGGLLDPACQKTDHFLS
CYPWFHGPISRVKAAQLVQLQGPDAHGVFLVRQSETRRGEYVLTFNFQGIAKHLRLSLTE
RGQCRVQHLHFPSVVDMLHHFQRSPIPLECGAACDVRLSSYVVVVSQPPGSCNTVLFPFS
LPHWDSESLPHWGSELGLPHLSSSGCPRGLSPEGLPGRSSPPEQIFHLVPSPEELANSLQ
HLEHEPVNRARDSDYEMDSSSRSHLRAIDNQYTPL
NT seq 1728 nt   +upstreamnt  +downstreamnt
atgaacgggcctgccctgcagccctcctcgccctcttccgcgccctcagcctccccggcg
gcggccccgcggggctggagcgagttctgtgagttgcacgccgtagcggcggcccgggag
ctggcccgccagtactggctgttcgcccgggagcatccgcagcacgcgccgctgcgcgcc
gagctggtgtcgctgcagttcaccgacctcttccagcgctacttctgccgcgaggtgcgc
gacggacgggcgccgggccgcgactaccgggacacaggccgtgggcccccagccaaggcc
gaggcgtccccggagccaggccccggccccgccgcccctggcctgcccaaggcccgcagc
tctgaggagctggccccgccgcggccgcccgggccctgctccttccagcactttcgccgc
agcctccgccacatcttccgccgccgctcggccggggagctgccagcggcccacaccgct
gccgcccccgggacccccggagaggctgctgagacccccgcccggcctggcctggccaag
aagttcctgccctggagcctggcccgggagccgccacccgaggcgctgaaggaggcggtg
ctgcgctacagcctggccgacgaggcctccatggacagcggggcacgctggcagcgcggg
aggctggcgctgcgccgggccccgggccccgatggccccgaccgcgtgctggagctcttc
gacccacccaagagttcaaggcccaagctacaagcagcttgctccagcatccaggaggtc
cggtggtgcacacggcttgagatgcctgacaacctttacacctttgtgctgaaggtgaag
gaccggacagacatcatctttgaggtgggagacgagcagcagctgaattcatggatggct
gagctctcggagtgcacaggccgagggctggagagcacagaagcagagatgcatattccc
tcagccctagagcctagcacgtccagctccccaaggggcagcacagattcccttaaccaa
ggtgcttctcctggggggctgctggacccggcctgccagaagacggaccatttcctgtcc
tgctacccctggttccacggccccatctccagagtgaaagcagctcagctggttcagctg
cagggccctgatgctcatggagtgttcctggtgcggcagagcgagacgcggcgtggggaa
tacgtgctcactttcaactttcaggggatagccaagcacctgcgcctgtcgctgacagag
cggggccagtgccgtgtgcagcacctccactttccctcggtcgtggacatgctccaccac
ttccagcgctcgcccatcccactcgagtgcggcgccgcctgtgatgtccggctctccagc
tacgtggtagtcgtctcccaaccaccaggttcctgcaacacggtcctcttccctttctcc
cttcctcactgggattcagagtcccttcctcactggggttcagagttgggccttccccac
cttagttcttctggctgtccccgggggctcagcccagagggtctcccagggcgatcctca
ccccccgagcagatcttccacctggtgccttcgcccgaagaactggccaacagcctgcag
cacctggagcatgagcctgtgaatcgagcccgggactcggactacgaaatggactcatcc
tcccggagccacctgcgggccatagacaatcagtacacacctctctga

KEGG   Homo sapiens (human): 25970
Entry
25970             CDS       T01001                                 
Symbol
SH2B1, PSM, SH2B
Name
(RefSeq) SH2B adaptor protein 1
  KO
K12459  SH2B adaptor protein 1/3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04722  Neurotrophin signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    25970 (SH2B1)
SSDB
Motif
Pfam: Phe_ZIP SH2 PH PI3K_rbd
Other DBs
NCBI-GeneID: 25970
NCBI-ProteinID: NP_001139267
OMIM: 608937
HGNC: 30417
Ensembl: ENSG00000178188
Pharos: Q9NRF2(Tbio)
UniProt: Q9NRF2 A0A024QZD2 B4DLN5 B3KNV5
Structure
LinkDB
Position
16:28846606..28874205
AA seq 756 aa
MNGAPSPEDGASPSSPPLPPPPPPSWREFCESHARAAALDFARRFRLYLASHPQYAGPGA
EAAFSRRFAELFLQHFEAEVARASGSLSPPILAPLSPGAEISPHDLSLESCRVGGPLAVL
GPSRSSEDLAGPLPSSVSSSSTTSSKPKLKKRFSLRSVGRSVRGSVRGILQWRGTVDPPS
SAGPLETSSGPPVLGGNSNSNSSGGAGTVGRGLVSDGTSPGERWTHRFERLRLSRGGGAL
KDGAGMVQREELLSFMGAEEAAPDPAGVGRGGGVAGPPSGGGGQPQWQKCRLLLRSEGEG
GGGSRLEFFVPPKASRPRLSIPCSSITDVRTTTALEMPDRENTFVVKVEGPSEYIMETVD
AQHVKAWVSDIQECLSPGPCPATSPRPMTLPLAPGTSFLTRENTDSLELSCLNHSESLPS
QDLLLGPSESNDRLSQGAYGGLSDRPSASISPSSASIAASHFDSMELLPPELPPRIPIEE
GPPTGTVHPLSAPYPPLDTPETATGSFLFQGEPEGGEGDQPLSGYPWFHGMLSRLKAAQL
VLTGGTGSHGVFLVRQSETRRGEYVLTFNFQGKAKHLRLSLNEEGQCRVQHLWFQSIFDM
LEHFRVHPIPLESGGSSDVVLVSYVPSSQRQQEPTTSHDPPQPPEPPSWTDPPQPGAEEA
SRAPEVAAAAAAAAKERQEKEKAGGGGVPEELVPVVELVPVVELEEAIAPGSEAQGAGSG
GDAGVPPMVQLQQSPLGGDGEEGGHPRAINNQYSFV
NT seq 2271 nt   +upstreamnt  +downstreamnt
atgaatggtgccccttccccagaggacggggcctccccctcgtctcccccgctgccccca
cccccgccccctagttggcgggagttctgtgagtcccacgcccgggctgcggctctggac
tttgcccgccgttttcgcctctacctggcctcccacccccaatatgcggggcccggggcc
gaggctgccttctcccgccgttttgctgagctcttcctgcagcactttgaagccgaggtg
gcccgggcctctggctccctgtcgccacccatcctggctcccctgagccctggtgcggag
atttcgccacatgacctgtcccttgagagctgcagggtgggtgggcccctggctgtgctg
ggcccttctcgatcatctgaggacctggccggccccctcccttcctcagtctcttcctcc
tctacaacctcctccaagccgaagctcaagaagcgcttttccctgcgttcagtgggtcgc
tctgtccgaggctcagtccgtggcatcctgcagtggcgggggaccgttgaccctccctcc
tccgctgggcccctggagacctcgtcaggccccccagtcttaggtggaaacagcaactcc
aactcctctggcggggctgggaccgttggtaggggactggtcagtgatggaacgtcccct
ggggaaagatggactcaccgttttgagaggctgagactcagtcggggagggggcgccttg
aaggatggagcagggatggtgcagagggaagagctgctgagtttcatgggggctgaggag
gcagcccctgacccagccggagtgggccggggaggaggggtggctgggcctccttcaggg
ggaggagggcagcctcagtggcagaagtgtcgcctgctgcttcgaagtgaaggagaagga
ggaggaggaagtcgcctggagttctttgtaccacccaaggcctctcggccccgactcagc
atcccctgctcttctatcacagacgtccggacaaccacagccctggagatgcctgaccgg
gagaacacgtttgtggttaaggtggaaggtccatccgagtatatcatggagacagtggat
gcccagcatgtgaaggcctgggtgtctgacatccaagaatgcctgagcccaggaccctgc
cctgctaccagtccccgccccatgaccctccctctggcccctgggacctcattccttaca
agggagaacacagacagcctggagctgtcctgcctgaatcactcggagagtctacccagc
caggacctgctgcttggacccagcgagagcaatgaccgcctgtcgcagggggcatatggg
ggcctctcagaccgcccctcggcatccatctcccccagctctgcctccattgccgcctcc
cattttgactcgatggaactgcttcccccagagttgcccccccgcatccccattgaagag
ggacccccaacagggacagttcatcccctctcagccccctaccctcccttggacactccg
gaaacagccacagggtccttcctgttccagggggagccagagggcggtgagggggaccag
cccctctcagggtatccttggttccacgggatgctctctcggctcaaggctgcacagttg
gtgctgactggcggcactggctcccacggtgtcttcctggtgcgccagagtgagacaagg
cggggtgaatacgtcctcaccttcaacttccagggcaaggccaagcacctgcgtttgtcg
ctgaacgaggagggtcagtgccgggtccagcacctgtggttccagtccattttcgatatg
ctcgagcacttccgggtgcaccccatccctttggagtcgggaggctccagtgatgttgtc
cttgtcagctatgtcccatcctcccagcgacagcaggaaccgaccacctcccatgaccca
ccccagccccctgaacccccttcatggacagatcccccacagcctggggcagaagaggcg
tcgagggcgccagaagtggcggcagcagcagccgcagcagccaaagagaggcaagagaaa
gagaaagcgggcggtggaggggtcccggaagagctggtccccgtggttgagctggtcccc
gtggttgaattggaagaggccatagccccaggctcagaggcccagggcgctgggtctggt
ggggacgcgggggtgcccccaatggtgcagctgcagcagtcaccactagggggtgatgga
gaggaagggggccaccccagggccattaacaaccagtactccttcgtgtga

DBGET integrated database retrieval system