KEGG   Homo sapiens (human): 10022
Entry
10022             CDS       T01001                                 
Symbol
INSL5, PRO182, UNQ156
Name
(RefSeq) insulin like 5
  KO
K22001  insulin-like 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04926  Relaxin signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    10022 (INSL5)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    10022 (INSL5)
SSDB
Motif
Pfam: Insulin Ins_beta
Other DBs
NCBI-GeneID: 10022
NCBI-ProteinID: NP_005469
OMIM: 606413
HGNC: 6088
Ensembl: ENSG00000172410
Pharos: Q9Y5Q6(Tbio)
CPD: C16178
UniProt: Q9Y5Q6
Structure
LinkDB
Position
1:complement(66797740..66801276)
AA seq 135 aa
MKGSIFTLFLFSVLFAISEVRSKESVRLCGLEYIRTVIYICASSRWRRHQEGIPQAQQAE
TGNSFQLPHKREFSEENPAQNLPKVDASGEDRLWGGQMPTEELWKSKKHSVMSRQDLQTL
CCTDGCSMTDLSALC
NT seq 408 nt   +upstreamnt  +downstreamnt
atgaagggctccattttcactctgtttttattctctgtcctatttgccatctcagaagtg
cggagcaaggagtctgtgagactctgtgggctagaatacatacggacagtcatctatatc
tgtgctagctccaggtggagaaggcatcaggaggggatccctcaagctcagcaagctgag
acaggaaactccttccagctcccacataaacgtgagttttctgaggaaaatccagcgcaa
aaccttccgaaggtggatgcctcaggggaagaccgtctttggggtggacagatgcccact
gaagagctttggaagtcaaagaagcattcagtgatgtcaagacaagatttacaaactttg
tgttgcactgatggctgttccatgactgatttgagtgctctttgctaa

KEGG   Homo sapiens (human): 117579
Entry
117579            CDS       T01001                                 
Symbol
RLN3, H3, RXN3, ZINS4, insl7
Name
(RefSeq) relaxin 3
  KO
K22000  relaxin 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04926  Relaxin signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    117579 (RLN3)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    117579 (RLN3)
SSDB
Motif
Pfam: Insulin Ins_beta
Other DBs
NCBI-GeneID: 117579
NCBI-ProteinID: NP_543140
OMIM: 606855
HGNC: 17135
Ensembl: ENSG00000171136
Pharos: Q8WXF3(Tbio)
CPD: C16123
UniProt: Q8WXF3 B2RU28
Structure
LinkDB
Position
19:14028148..14031551
AA seq 142 aa
MARYMLLLLLAVWVLTGELWPGAEARAAPYGVRLCGREFIRAVIFTCGGSRWRRSDILAH
EAMGDTFPDADADEDSLAGELDEAMGSSEWLALTKSPQAFYRGRPSWQGTPGVLRGSRDV
LAGLSSSCCKWGCSKSEISSLC
NT seq 429 nt   +upstreamnt  +downstreamnt
atggccaggtacatgctgctgctgctcctggcggtatgggtgctgaccggggagctgtgg
ccgggagctgaggcccgggcagcgccttacggggtcaggctttgcggccgagaattcatc
cgagcagtcatcttcacctgcgggggctcccggtggagacgatcagacatcctggcccac
gaggctatgggagataccttcccggatgcagatgctgatgaagacagtctggcaggcgag
ctggatgaggccatggggtccagcgagtggctggccctgaccaagtcaccccaggccttt
tacagggggcgacccagctggcaaggaacccctggggttcttcggggcagccgagatgtc
ctggctggcctttccagcagctgctgcaagtgggggtgtagcaaaagtgaaatcagtagc
ctttgctag

KEGG   Homo sapiens (human): 3640
Entry
3640              CDS       T01001                                 
Symbol
INSL3, RLF, RLNL, ley-I-L
Name
(RefSeq) insulin like 3
  KO
K21999  insulin-like 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04926  Relaxin signaling pathway
Disease
H02176  Cryptorchidism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    3640 (INSL3)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    3640 (INSL3)
SSDB
Motif
Pfam: Insulin Rrp40_N EAD7
Other DBs
NCBI-GeneID: 3640
NCBI-ProteinID: NP_005534
OMIM: 146738
HGNC: 6086
Ensembl: ENSG00000248099
Pharos: P51460(Tbio)
CPD: C16124
UniProt: P51460
Structure
LinkDB
Position
19:complement(17816512..17821519)
AA seq 131 aa
MDPRLPAWALVLLGPALVFALGPAPTPEMREKLCGHHFVRALVRVCGGPRWSTEARRPAT
GGDRELLQWLERRHLLHGLVADSNLTLGPGLQPLPQTSHHHRHHRAAATNPARYCCLSGC
TQQDLLTLCPY
NT seq 396 nt   +upstreamnt  +downstreamnt
atggacccccgtctgcccgcctgggcgctggtgctgctgggccctgccctggtgttcgcg
ttgggccccgcgcccaccccagagatgcgtgagaagttgtgcggccaccacttcgtacgc
gcgctagtgcgcgtgtgcgggggcccccgctggtccaccgaagccaggaggcctgcgacc
ggaggcgaccgtgagttgctacagtggctggagagacgacatctgctccatgggctggtg
gccgacagtaatctcacgctgggacctggcctgcagcccctgccccagacctctcaccat
caccgccaccaccgtgcagctgccaccaaccctgcacgctactgctgcctcagtggctgt
acccaacaagacctgctgaccctctgtccctactga

KEGG   Homo sapiens (human): 6013
Entry
6013              CDS       T01001                                 
Symbol
RLN1, H1, H1RLX, RLXH1, bA12D24.3.1, bA12D24.3.2
Name
(RefSeq) relaxin 1
  KO
K21998  relaxin 1/2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04926  Relaxin signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    6013 (RLN1)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    6013 (RLN1)
SSDB
Motif
Pfam: Insulin
Other DBs
NCBI-GeneID: 6013
NCBI-ProteinID: NP_008842
OMIM: 179730
HGNC: 10026
Ensembl: ENSG00000107018
Pharos: P04808(Tbio)
CPD: C16121
UniProt: P04808
LinkDB
Position
9:complement(5334930..5340916)
AA seq 185 aa
MPRLFLFHLLEFCLLLNQFSRAVAAKWKDDVIKLCGRELVRAQIAICGMSTWSKRSLSQE
DAPQTPRPVAEIVPSFINKDTETIIIMLEFIANLPPELKAALSERQPSLPELQQYVPALK
DSNLSFEEFKKLIRNRQSEAADSNPSELKYLGLDTHSQKKRRPYVALFEKCCLIGCTKRS
LAKYC
NT seq 558 nt   +upstreamnt  +downstreamnt
atgcctcgcctgttcttgttccacctgctagaattctgtttactactgaaccaattttcc
agagcagtcgcggccaaatggaaggacgatgttattaaattatgcggccgcgaattagtt
cgcgcgcagattgccatttgcggcatgagcacctggagcaaaaggtctctgagccaggaa
gatgctcctcagacacctagaccagtggcagaaattgtaccatccttcatcaacaaagat
acagaaactataattatcatgttggaattcattgctaatttgccaccggagctgaaggca
gccctatctgagaggcaaccatcattaccagagctacagcagtatgtacctgcattaaag
gattccaatcttagctttgaagaatttaagaaacttattcgcaataggcaaagtgaagcc
gcagacagcaatccttcagaattaaaatacttaggcttggatactcattctcaaaaaaag
agacgaccctacgtggcactgtttgagaaatgttgcctaattggttgtaccaaaaggtct
cttgctaaatattgctga

KEGG   Homo sapiens (human): 6019
Entry
6019              CDS       T01001                                 
Symbol
RLN2, H2, H2-RLX, RLXH2, bA12D24.1.1, bA12D24.1.2
Name
(RefSeq) relaxin 2
  KO
K21998  relaxin 1/2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04926  Relaxin signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    6019 (RLN2)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    6019 (RLN2)
SSDB
Motif
Pfam: Insulin
Other DBs
NCBI-GeneID: 6019
NCBI-ProteinID: NP_604390
OMIM: 179740
HGNC: 10027
Ensembl: ENSG00000107014
Pharos: P04090(Tbio)
CPD: C16122
UniProt: P04090
Structure
LinkDB
Position
9:complement(5299864..5339326)
AA seq 185 aa
MPRLFFFHLLGVCLLLNQFSRAVADSWMEEVIKLCGRELVRAQIAICGMSTWSKRSLSQE
DAPQTPRPVAEIVPSFINKDTETINMMSEFVANLPQELKLTLSEMQPALPQLQQHVPVLK
DSSLLFEEFKKLIRNRQSEAADSSPSELKYLGLDTHSRKKRQLYSALANKCCHVGCTKRS
LARFC
NT seq 558 nt   +upstreamnt  +downstreamnt
atgcctcgcctgttttttttccacctgctaggagtctgtttactactgaaccaattttcc
agagcagtcgcggactcatggatggaggaagttattaaattatgcggccgcgaattagtt
cgcgcgcagattgccatttgcggcatgagcacctggagcaaaaggtctctgagccaggaa
gatgctcctcagacacctagaccagtggcagaaattgtgccatccttcatcaacaaagat
acagaaaccataaatatgatgtcagaatttgttgctaatttgccacaggagctgaagtta
accctgtctgagatgcagccagcattaccacagctacaacaacatgtacctgtattaaaa
gattccagtcttctctttgaagaatttaagaaacttattcgcaatagacaaagtgaagcc
gcagacagcagtccttcagaattaaaatacttaggcttggatactcattctcgaaaaaag
agacaactctacagtgcattggctaataaatgttgccatgttggttgtaccaaaagatct
cttgctagattttgctga

DBGET integrated database retrieval system