KEGG   Homo sapiens (human): 100526739
Entry
100526739         CDS       T01001                                 

Symbol
CENPS-CORT, APITD1, APITD1-CORT, CENP-S, CENPS, FAAP16, MHF1
Name
(RefSeq) CENPS-CORT readthrough
  KO
K11511  centromere protein S
Organism
hsa  Homo sapiens (human)
Pathway
hsa03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    100526739 (CENPS-CORT)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    100526739 (CENPS-CORT)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    100526739 (CENPS-CORT)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    Centromere proteins
     100526739 (CENPS-CORT)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   FA (Fanconi anemia) pathway
    FA core complex binding factors
     100526739 (CENPS-CORT)
SSDB
Motif
Pfam: CENP-S CENP-T_C Histone COMMD1_N Bromo_TP DUF4087
Other DBs
NCBI-GeneID: 100526739
NCBI-ProteinID: NP_001257446
HGNC: 38843
Ensembl: ENSG00000251503
Vega: OTTHUMG00000162436
UniProt: Q8N2Z9
LinkDB
Structure
PDB: 

Position
1p36.22
AA seq 138 aa
MEEEAETEEQQRFSYQQRLKAAVHYTVGCLCEEVALDKEMQFSKQTIAAISELTFRQCEN
FAKDLEMFARHAKRTTINTEDVKLLARRSNSLLKYITDKSEEIAQINLERKAQKKKKSED
GSKNSRQPAEAGVVESEN
NT seq 417 nt   +upstreamnt  +downstreamnt
atggaggaggaggcggagaccgaggagcagcagcgattctcttaccaacagaggctaaag
gcagcagttcactatactgtgggttgtctttgcgaggaagttgcattggacaaagagatg
cagttcagcaaacagaccattgcggccatttcggagctgactttccgacagtgtgaaaat
tttgccaaagaccttgaaatgtttgcaagacatgcgaaaagaaccacaattaacactgaa
gatgtgaagctcttagccaggaggagtaattcactgctaaaatacatcacagacaaaagt
gaagagattgctcagattaacctagaacgaaaagcacagaagaaaaagaagtcagaggat
ggaagcaaaaattcaaggcagccagcagaggctggagtggtggaaagtgagaattaa

KEGG   Homo sapiens (human): 201254
Entry
201254            CDS       T01001                                 

Symbol
CENPX, CENP-X, D9, FAAP10, MHF2, STRA13
Name
(RefSeq) centromere protein X
  KO
K15360  centromere protein X
Organism
hsa  Homo sapiens (human)
Pathway
hsa03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    201254 (CENPX)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    201254 (CENPX)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   FA (Fanconi anemia) pathway
    FA core complex binding factors
     201254 (CENPX)
SSDB
Motif
Pfam: CENP-X CBFD_NFYB_HMF
Other DBs
NCBI-GeneID: 201254
NCBI-ProteinID: NP_001257935
OMIM: 615128
HGNC: 11422
Ensembl: ENSG00000169689
Vega: OTTHUMG00000132129
Pharos: A8MT69(Tbio)
UniProt: A8MT69
LinkDB
Structure
PDB: 

Position
17q25.3
AA seq 81 aa
MEGAGAGSGFRKELVSRLLHLHFKDDKTKVSGDALQLMVELLKVFVVEAAVRGVRQAQAE
DALRVDVDQLEKVLPQLLLDF
NT seq 246 nt   +upstreamnt  +downstreamnt
atggagggagcaggagctggatccggcttccggaaggagctggtgagcaggctgctgcac
ctgcacttcaaggatgacaagaccaaagtgagcggggacgcgctgcagctcatggtggag
ttgctgaaggtcttcgttgtggaagcagcagtccgcggcgtgcggcaggcccaggcagaa
gacgcgctccgtgtggacgtggaccagctggagaaggtgcttccgcagctgctcctggac
ttctag

KEGG   Homo sapiens (human): 378708
Entry
378708            CDS       T01001                                 

Symbol
CENPS, APITD1, CENP-S, FAAP16, MHF1
Name
(RefSeq) centromere protein S
  KO
K11511  centromere protein S
Organism
hsa  Homo sapiens (human)
Pathway
hsa03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    378708 (CENPS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    378708 (CENPS)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    378708 (CENPS)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    Centromere proteins
     378708 (CENPS)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   FA (Fanconi anemia) pathway
    FA core complex binding factors
     378708 (CENPS)
SSDB
Motif
Pfam: CENP-S CENP-T_C Histone COMMD1_N Bromo_TP DUF4087
Other DBs
NCBI-GeneID: 378708
NCBI-ProteinID: NP_954988
OMIM: 609130
HGNC: 23163
Ensembl: ENSG00000175279
Vega: OTTHUMG00000059085
Pharos: Q8N2Z9(Tbio)
UniProt: Q8N2Z9
LinkDB
Structure
PDB: 

Position
1p36.22
AA seq 138 aa
MEEEAETEEQQRFSYQQRLKAAVHYTVGCLCEEVALDKEMQFSKQTIAAISELTFRQCEN
FAKDLEMFARHAKRTTINTEDVKLLARRSNSLLKYITDKSEEIAQINLERKAQKKKKSED
GSKNSRQPAEAGVVESEN
NT seq 417 nt   +upstreamnt  +downstreamnt
atggaggaggaggcggagaccgaggagcagcagcgattctcttaccaacagaggctaaag
gcagcagttcactatactgtgggttgtctttgcgaggaagttgcattggacaaagagatg
cagttcagcaaacagaccattgcggccatttcggagctgactttccgacagtgtgaaaat
tttgccaaagaccttgaaatgtttgcaagacatgcgaaaagaaccacaattaacactgaa
gatgtgaagctcttagccaggaggagtaattcactgctaaaatacatcacagacaaaagt
gaagagattgctcagattaacctagaacgaaaagcacagaagaaaaagaagtcagaggat
ggaagcaaaaattcaaggcagccagcagaggctggagtggtggaaagtgagaattaa

DBGET integrated database retrieval system