KEGG   Homo sapiens (human): 100526767
Entry
100526767         CDS       T01001                                 
Symbol
RNF103-CHMP3, CGI149, CHMP3, NEDF, RNF103-VPS24, VPS24, hVps24
Name
(RefSeq) RNF103-CHMP3 readthrough
  KO
K12193  charged multivesicular body protein 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100526767 (RNF103-CHMP3)
  09143 Cell growth and death
   04217 Necroptosis
    100526767 (RNF103-CHMP3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    100526767 (RNF103-CHMP3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    100526767 (RNF103-CHMP3)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-III complex
    100526767 (RNF103-CHMP3)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100526767 (RNF103-CHMP3)
SSDB
Motif
Pfam: Snf7 CTD6 AAA_6 DUF3915 RraB zf-ZPR1
Other DBs
NCBI-GeneID: 100526767
NCBI-ProteinID: NP_001185883
HGNC: 38847
Ensembl: ENSG00000249884
UniProt: Q9Y3E7
Structure
LinkDB
Position
2:complement(86503430..86721122)
AA seq 251 aa
MEGELYSALKEEEASESVSSTNFSGEMHFYELVEDTKDGIWLVQVNEWSLKIRKEMRVVD
RQIRDIQREEEKVKRSVKDAAKKGQKDVCIVLAKEMIRSRKAVSKLYASKAHMNSVLMGM
KNQLAVLRVAGSLQKSTEVMKAMQSLVKIPEIQATMRELSKEMMKAGIIEEMLEDTFESM
DDQEEMEEEAEMEIDRILFEITAGALGKAPSKVTDALPEPEPPGAMAASEDEEEEEEALE
AMQSRLATLRS
NT seq 756 nt   +upstreamnt  +downstreamnt
atggagggtgagctctattctgctctcaaggaagaagaagcatccgaatcggtttctagt
accaatttcagtggtgaaatgcacttctatgagcttgtggaagacacaaaagatggcatc
tggctggttcaggtcaatgagtggtcattgaagataagaaaggaaatgagagttgttgac
aggcaaataagggatatccaaagagaagaagaaaaagtgaaacgatctgtgaaagatgct
gccaagaagggccagaaggatgtctgcatagttctggccaaggagatgatcaggtcaagg
aaggctgtgagcaagctgtatgcatccaaagcacacatgaactcagtgctcatggggatg
aagaaccagctcgcggtcttgcgagtggctggttccctgcagaagagcacagaagtgatg
aaggccatgcaaagtcttgtgaagattccagagattcaggccaccatgagggagttgtcc
aaagaaatgatgaaggctgggatcatagaggagatgttagaggacacttttgaaagcatg
gacgatcaggaagaaatggaggaagaagcagaaatggaaattgacagaattctctttgaa
attacagcaggggccttgggcaaagcacccagtaaagtgactgatgcccttccagagcca
gaacctccaggagcgatggctgcctcagaggatgaggaggaggaggaagaggctctggag
gccatgcagtcccggctggccacactccgcagctag

KEGG   Homo sapiens (human): 128866
Entry
128866            CDS       T01001                                 
Symbol
CHMP4B, C20orf178, CHMP4A, CTPP3, CTRCT31, SNF7, SNF7-2, Shax1, VPS32B, Vps32-2, dJ553F4.4
Name
(RefSeq) charged multivesicular body protein 4B
  KO
K12194  charged multivesicular body protein 4A/B
Organism
hsa  Homo sapiens (human)
Pathway
hsa03250  Viral life cycle - HIV-1
hsa04144  Endocytosis
hsa04217  Necroptosis
Disease
H01202  Cataract
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09125 Information processing in viruses
   03250 Viral life cycle - HIV-1
    128866 (CHMP4B)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    128866 (CHMP4B)
  09143 Cell growth and death
   04217 Necroptosis
    128866 (CHMP4B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    128866 (CHMP4B)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    128866 (CHMP4B)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-III complex
    128866 (CHMP4B)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   128866 (CHMP4B)
  Exosomal proteins of other body fluids (saliva and urine)
   128866 (CHMP4B)
  Exosomal proteins of colorectal cancer cells
   128866 (CHMP4B)
SSDB
Motif
Pfam: Snf7 SYF2
Other DBs
NCBI-GeneID: 128866
NCBI-ProteinID: NP_789782
OMIM: 610897
HGNC: 16171
Ensembl: ENSG00000101421
Pharos: Q9H444(Tbio)
UniProt: Q9H444
Structure
LinkDB
Position
20:33811348..33854366
AA seq 224 aa
MSVFGKLFGAGGGKAGKGGPTPQEAIQRLRDTEEMLSKKQEFLEKKIEQELTAAKKHGTK
NKRAALQALKRKKRYEKQLAQIDGTLSTIEFQREALENANTNTEVLKNMGYAAKAMKAAH
DNMDIDKVDELMQDIADQQELAEEISTAISKPVGFGEEFDEDELMAELEELEQEELDKNL
LEISGPETVPLPNVPSIALPSKPAKKKEEEDDDMKELENWAGSM
NT seq 675 nt   +upstreamnt  +downstreamnt
atgtcggtgttcgggaagctgttcggggctggagggggtaaggccggcaagggcggcccg
accccccaggaggccatccagcggctgcgggacacggaagagatgttaagcaagaaacag
gagttcctggagaagaaaatcgagcaggagctgacggccgccaagaagcacggcaccaaa
aacaagcgcgcggccctccaggcactgaagcgtaagaagaggtatgagaagcagctggcg
cagatcgacggcacattatcaaccatcgagttccagcgggaggccctggagaatgccaac
accaacaccgaggtgctcaagaacatgggctatgccgccaaggccatgaaggcggcccat
gacaacatggacatcgataaagttgatgagttaatgcaggacattgctgaccagcaagaa
cttgcagaggagatttcaacagcaatttcgaaacctgtagggtttggagaagagtttgac
gaggatgagctcatggcggaattagaagaactagaacaggaggaactagacaagaatttg
ctggaaatcagtggacccgaaacagtccctctaccaaatgttccctctatagccctacca
tcaaaacccgccaagaagaaagaagaggaggacgacgacatgaaggaattggagaactgg
gctggatccatgtaa

KEGG   Homo sapiens (human): 25978
Entry
25978             CDS       T01001                                 
Symbol
CHMP2B, ALS17, CHMP2.5, DMT1, FTDALS7, VPS2-2, VPS2B
Name
(RefSeq) charged multivesicular body protein 2B
  KO
K12192  charged multivesicular body protein 2B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04217  Necroptosis
hsa05014  Amyotrophic lateral sclerosis
hsa05022  Pathways of neurodegeneration - multiple diseases
Disease
H02342  Frontotemporal dementia and amyotrophic lateral sclerosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    25978 (CHMP2B)
  09143 Cell growth and death
   04217 Necroptosis
    25978 (CHMP2B)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    25978 (CHMP2B)
   05022 Pathways of neurodegeneration - multiple diseases
    25978 (CHMP2B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    25978 (CHMP2B)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    25978 (CHMP2B)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-III complex
    25978 (CHMP2B)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   25978 (CHMP2B)
SSDB
Motif
Pfam: Snf7 DnaJ-X DUF3456
Other DBs
NCBI-GeneID: 25978
NCBI-ProteinID: NP_054762
OMIM: 609512
HGNC: 24537
Ensembl: ENSG00000083937
Pharos: Q9UQN3(Tbio)
UniProt: Q9UQN3 B2RE76
Structure
LinkDB
Position
3:87227309..87255556
AA seq 213 aa
MASLFKKKTVDDVIKEQNRELRGTQRAIIRDRAALEKQEKQLELEIKKMAKIGNKEACKV
LAKQLVHLRKQKTRTFAVSSKVTSMSTQTKVMNSQMKMAGAMSTTAKTMQAVNKKMDPQK
TLQTMQNFQKENMKMEMTEEMINDTLDDIFDGSDDEEESQDIVNQVLDEIGIEISGKMAK
APSAARSLPSASTSKATISDEEIERQLKALGVD
NT seq 642 nt   +upstreamnt  +downstreamnt
atggcgtccctcttcaagaagaaaaccgtggatgatgtaataaaggaacagaatcgagag
ttacgaggtacacagagggctataatcagagatcgagcagctttagagaaacaagaaaaa
cagctggaattagaaattaagaaaatggccaagattggtaataaggaagcttgcaaagtt
ttagccaaacaacttgtgcatctacggaaacagaagacgagaacttttgctgtaagttca
aaagttacttctatgtctacacaaacaaaagtgatgaattcccaaatgaagatggctgga
gcaatgtctactacagcaaaaacaatgcaggcagttaacaagaagatggatccacaaaag
acattacaaacaatgcagaatttccagaaggaaaacatgaaaatggaaatgactgaagaa
atgatcaatgatacacttgatgacatctttgacggttctgatgacgaagaagaaagccag
gatattgtgaatcaagttcttgatgaaattggaattgaaatttctggaaagatggccaaa
gctccatcagctgctcgaagcttaccatctgcctctacttcaaaggctacaatctcagat
gaagagattgaacggcaactcaaggctttaggagtagattag

KEGG   Homo sapiens (human): 27183
Entry
27183             CDS       T01001                                 
Symbol
VPS4A, CIMDAG, SKD1, SKD1A, SKD2, VPS4, VPS4-1
Name
(RefSeq) vacuolar protein sorting 4 homolog A
  KO
K12196  vacuolar protein-sorting-associated protein 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa03250  Viral life cycle - HIV-1
hsa04144  Endocytosis
hsa04217  Necroptosis
Disease
H02548  CIMDAG syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09125 Information processing in viruses
   03250 Viral life cycle - HIV-1
    27183 (VPS4A)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    27183 (VPS4A)
  09143 Cell growth and death
   04217 Necroptosis
    27183 (VPS4A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    27183 (VPS4A)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    27183 (VPS4A)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-III complex
    27183 (VPS4A)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    27183 (VPS4A)
SSDB
Motif
Pfam: AAA Vps4_C MIT AAA_lid_3 TIP49 AAA_16 AAA_22 RuvB_N IstB_IS21 AAA_5 AAA_14 AAA_25 AAA_18 DUF815 AAA_2 AAA_33 AAA_17 RNA_helicase AAA_24 PhoH NACHT AAA_7 Mg_chelatase DUF5906 Sigma54_activat bpMoxR Sigma54_activ_2 YhdB YCII
Other DBs
NCBI-GeneID: 27183
NCBI-ProteinID: NP_037377
OMIM: 609982
HGNC: 13488
Ensembl: ENSG00000132612
Pharos: Q9UN37(Tbio)
UniProt: Q9UN37 A0A024R705
Structure
LinkDB
Position
16:69311350..69326939
AA seq 437 aa
MTTSTLQKAIDLVTKATEEDKAKNYEEALRLYQHAVEYFLHAIKYEAHSDKAKESIRAKC
VQYLDRAEKLKDYLRSKEKHGKKPVKENQSEGKGSDSDSEGDNPEKKKLQEQLMGAVVME
KPNIRWNDVAGLEGAKEALKEAVILPIKFPHLFTGKRTPWRGILLFGPPGTGKSYLAKAV
ATEANNSTFFSVSSSDLMSKWLGESEKLVKNLFELARQHKPSIIFIDEVDSLCGSRNENE
SEAARRIKTEFLVQMQGVGNNNDGTLVLGATNIPWVLDSAIRRRFEKRIYIPLPEEAARA
QMFRLHLGSTPHNLTDANIHELARKTEGYSGADISIIVRDSLMQPVRKVQSATHFKKVCG
PSRTNPSMMIDDLLTPCSPGDPGAMEMTWMDVPGDKLLEPVVCMSDMLRSLATTRPTVNA
DDLLKVKKFSEDFGQES
NT seq 1314 nt   +upstreamnt  +downstreamnt
atgacaacgtcaaccctccagaaagccattgatctggtgacgaaagccacagaggaggac
aaagccaagaactacgaggaggcgctgcggctgtaccagcatgcggtggagtacttcctc
cacgctatcaagtatgaggcccacagcgacaaggccaaggagagcattcgagccaagtgc
gtgcagtacctagaccgggccgagaagctgaaggattatttacgaagcaaagagaaacac
ggcaagaagccagtcaaagagaaccagagtgagggcaagggcagtgacagtgacagtgaa
ggggataatccggagaaaaagaaactgcaagaacagctgatgggtgccgtcgtgatggag
aagcccaacatacggtggaacgacgtggccgggctggagggggccaaggaggccctcaaa
gaagctgtcattttgccaatcaaattcccacacttgttcacaggcaagcgcaccccctgg
cgggggattctgctgttcggaccccctggcacagggaaatcctacctggccaaagccgtg
gcaacagaggccaacaactccaccttcttctctgtgtcctcctcagatctgatgtccaag
tggctgggggagagtgaaaagctggtcaagaacctgtttgagctggccaggcagcacaag
ccctccatcatcttcatcgatgaggtggattccctctgcgggtcccgaaatgaaaatgag
agtgaggccgcccggaggatcaaaacggagttcttggtccagatgcagggggtggggaat
aacaatgatgggactctggttcttggagccacaaacatcccatgggtgttggattcggcc
atcaggaggaggtttgaaaaacgaatttatatccccttgccggaggaagctgcccgcgcc
cagatgttccggttgcatctcgggagcactccccacaacctcacggatgcaaacatccac
gagctggcccggaagacggaaggctactcgggcgcggacatcagcatcatcgtgcgggac
tctctcatgcagcccgtgaggaaggtgcagtcggccacacacttcaaaaaggtctgtggc
ccctctcgcaccaaccccagcatgatgattgatgacctcctgactccatgctcaccaggg
gacccaggagccatggagatgacttggatggatgtccctggggacaaactcttagagcct
gtggtttgcatgtcggacatgctgcggtctctggccaccacccggcccacggtgaatgca
gacgacctcctgaaagtgaagaaattctcagaggactttgggcaagagagttaa

KEGG   Homo sapiens (human): 27243
Entry
27243             CDS       T01001                                 
Symbol
CHMP2A, BC-2, BC2, CHMP2, VPS2, VPS2A
Name
(RefSeq) charged multivesicular body protein 2A
  KO
K12191  charged multivesicular body protein 2A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    27243 (CHMP2A)
  09143 Cell growth and death
   04217 Necroptosis
    27243 (CHMP2A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    27243 (CHMP2A)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    27243 (CHMP2A)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-III complex
    27243 (CHMP2A)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   27243 (CHMP2A)
  Exosomal proteins of other body fluids (saliva and urine)
   27243 (CHMP2A)
  Exosomal proteins of colorectal cancer cells
   27243 (CHMP2A)
SSDB
Motif
Pfam: Snf7
Other DBs
NCBI-GeneID: 27243
NCBI-ProteinID: NP_055268
OMIM: 610893
HGNC: 30216
Ensembl: ENSG00000130724
Pharos: O43633(Tbio)
UniProt: O43633 A0A024R4S0
LinkDB
Position
19:complement(58551566..58555105)
AA seq 222 aa
MDLLFGRRKTPEELLRQNQRALNRAMRELDRERQKLETQEKKIIADIKKMAKQGQMDAVR
IMAKDLVRTRRYVRKFVLMRANIQAVSLKIQTLKSNNSMAQAMKGVTKAMGTMNRQLKLP
QIQKIMMEFERQAEIMDMKEEMMNDAIDDAMGDEEDEEESDAVVSQVLDELGLSLTDELS
NLPSTGGSLSVAAGGKKAEAAASALADADADLEERLKNLRRD
NT seq 669 nt   +upstreamnt  +downstreamnt
atggacctattgttcgggcgccggaagacgccagaggagctactgcggcagaaccagagg
gccctgaaccgtgccatgcgggagctggaccgcgagcgacagaaactagagacccaggag
aagaaaatcattgcagacattaagaagatggccaagcaaggccagatggatgctgttcgc
atcatggcaaaagacttggtgcgcacccggcgctatgtgcgcaagtttgtattgatgcgg
gccaacatccaggctgtgtccctcaagatccagacactcaagtccaacaactcgatggca
caagccatgaagggtgtcaccaaggccatgggcaccatgaacagacagctgaagttgccc
cagatccagaagatcatgatggagtttgagcggcaggcagagatcatggatatgaaggag
gagatgatgaatgatgccattgatgatgccatgggtgatgaggaagatgaagaggagagt
gatgctgtggtgtcccaggttctggatgagctgggacttagcctaacagatgagctgtcg
aacctcccctcaactgggggctcgcttagtgtggctgctggtgggaaaaaagcagaggcc
gcagcctcagccctagctgatgctgatgcagacctggaggaacggcttaagaacctgcgg
agggactga

KEGG   Homo sapiens (human): 29082
Entry
29082             CDS       T01001                                 
Symbol
CHMP4A, C14orf123, CHMP4, CHMP4B, HSPC134, SHAX2, SNF7, SNF7-1, VPS32-1, VPS32A
Name
(RefSeq) charged multivesicular body protein 4A
  KO
K12194  charged multivesicular body protein 4A/B
Organism
hsa  Homo sapiens (human)
Pathway
hsa03250  Viral life cycle - HIV-1
hsa04144  Endocytosis
hsa04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09125 Information processing in viruses
   03250 Viral life cycle - HIV-1
    29082 (CHMP4A)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    29082 (CHMP4A)
  09143 Cell growth and death
   04217 Necroptosis
    29082 (CHMP4A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    29082 (CHMP4A)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    29082 (CHMP4A)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-III complex
    29082 (CHMP4A)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   29082 (CHMP4A)
  Exosomal proteins of other body fluids (saliva and urine)
   29082 (CHMP4A)
  Exosomal proteins of colorectal cancer cells
   29082 (CHMP4A)
SSDB
Motif
Pfam: Snf7 SYF2 CATRA-C Ribonuc_2-5A
Other DBs
NCBI-GeneID: 29082
NCBI-ProteinID: NP_054888
OMIM: 610051
HGNC: 20274
Ensembl: ENSG00000254505
Pharos: Q9BY43(Tbio)
UniProt: Q9BY43
Structure
LinkDB
Position
14:complement(24209615..24213488)
AA seq 222 aa
MSGLGRLFGKGKKEKGPTPEEAIQKLKETEKILIKKQEFLEQKIQQELQTAKKYGTKNKR
AALQALRRKKRFEQQLAQTDGTLSTLEFQREAIENATTNAEVLRTMELAAQSMKKAYQDM
DIDKVDELMTDITEQQEVAQQISDAISRPMGFGDDVDEDELLEELEELEQEELAQELLNV
GDKEEEPSVKLPSVPSTHLPAGPAPKVDEDEEALKQLAEWVS
NT seq 669 nt   +upstreamnt  +downstreamnt
atgagtggtctcggcaggctcttcgggaaggggaagaaggagaaagggccaacccctgaa
gaagcaatacagaaactgaaggagacagagaagatactgatcaagaaacaggaatttttg
gagcagaagattcaacaggagctacaaacagccaagaagtatgggaccaagaataagaga
gctgccctacaggctttgcggaggaagaaaagattcgaacagcagctggcacaaactgac
gggacattatccaccctggagtttcagcgtgaggccattgagaatgccactaccaatgca
gaagtccttcgtaccatggagcttgctgcccaaagcatgaagaaggcctaccaggacatg
gacattgacaaggtagatgaactgatgactgacatcacggaacaacaggaggtggcccag
cagatctcagatgccatttctcggcctatgggctttggagatgatgtggatgaggatgaa
ctgctggaggagctagaggagctggagcaggaggaattggcccaggagttgttaaatgtg
ggcgacaaggaagaagaaccctcagtcaaattgcctagtgtaccttctactcatctgccg
gcagggccagctcccaaagtggatgaagatgaagaagcactaaagcagttggctgagtgg
gtatcctga

KEGG   Homo sapiens (human): 5119
Entry
5119              CDS       T01001                                 
Symbol
CHMP1A, CHMP1, PCH8, PCOLN3, PRSM1, VPS46-1, VPS46A
Name
(RefSeq) charged multivesicular body protein 1A
  KO
K12197  charged multivesicular body protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04217  Necroptosis
Disease
H00897  Pontocerebellar hypoplasia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    5119 (CHMP1A)
  09143 Cell growth and death
   04217 Necroptosis
    5119 (CHMP1A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    5119 (CHMP1A)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    5119 (CHMP1A)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-III complex
    5119 (CHMP1A)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   5119 (CHMP1A)
  Exosomal proteins of other body fluids (saliva and urine)
   5119 (CHMP1A)
  Exosomal proteins of colorectal cancer cells
   5119 (CHMP1A)
SSDB
Motif
Pfam: Snf7 DUF6247 MS_channel Ist1
Other DBs
NCBI-GeneID: 5119
NCBI-ProteinID: NP_002759
OMIM: 164010
HGNC: 8740
Ensembl: ENSG00000131165
Pharos: Q9HD42(Tbio)
UniProt: Q9HD42
Structure
LinkDB
Position
16:complement(89644435..89657708)
AA seq 196 aa
MDDTLFQLKFTAKQLEKLAKKAEKDSKAEQAKVKKALLQKNVECARVYAENAIRKKNEGV
NWLRMASRVDAVASKVQTAVTMKGVTKNMAQVTKALDKALSTMDLQKVSSVMDRFEQQVQ
NLDVHTSVMEDSMSSATTLTTPQEQVDSLIMQIAEENGLEVLDQLSQLPEGASAVGESSV
RSQEDQLSRRLAALRN
NT seq 591 nt   +upstreamnt  +downstreamnt
atggacgataccctgttccagttgaagttcacggcgaagcagctggagaagctggccaag
aaggcggagaaggactccaaggcggagcaggccaaagtgaagaaggcccttctgcagaaa
aatgtagagtgtgcccgtgtgtatgccgagaacgccatccgcaagaagaacgaaggtgtg
aactggcttcggatggcgtcccgcgtagacgcagtggcctccaaggtgcagacagctgtg
actatgaagggggtgaccaagaatatggcccaggtgaccaaagccctggacaaggccctg
agcaccatggacctgcagaaggtctcctcagtgatggacaggttcgagcagcaggtgcag
aacctggacgtccatacatcggtgatggaggactccatgagctcggccaccaccctgacc
acgccgcaggagcaggtggacagcctcatcatgcagatcgccgaggagaatggcctggag
gtgctggaccagctcagccagctgcccgagggcgcctctgccgtgggcgagagctctgtg
cgcagccaggaggaccagctgtcacggaggttggccgccttgaggaactag

KEGG   Homo sapiens (human): 51510
Entry
51510             CDS       T01001                                 
Symbol
CHMP5, C9orf83, CGI-34, HSPC177, PNAS-2, SNF7DC2, Vps60
Name
(RefSeq) charged multivesicular body protein 5
  KO
K12198  charged multivesicular body protein 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    51510 (CHMP5)
  09143 Cell growth and death
   04217 Necroptosis
    51510 (CHMP5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    51510 (CHMP5)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-III complex
    51510 (CHMP5)
SSDB
Motif
Pfam: Snf7 NPV_P10 Prefoldin_2 Alpha-E DUF948 DUF6674 DUF848 TBCC_N
Other DBs
NCBI-GeneID: 51510
NCBI-ProteinID: NP_057494
OMIM: 610900
HGNC: 26942
Ensembl: ENSG00000086065
Pharos: Q9NZZ3(Tbio)
UniProt: Q9NZZ3
Structure
LinkDB
Position
9:33265049..33282070
AA seq 219 aa
MNRLFGKAKPKAPPPSLTDCIGTVDSRAESIDKKISRLDAELVKYKDQIKKMREGPAKNM
VKQKALRVLKQKRMYEQQRDNLAQQSFNMEQANYTIQSLKDTKTTVDAMKLGVKEMKKAY
KQVKIDQIEDLQDQLEDMMEDANEIQEALSRSYGTPELDEDDLEAELDALGDELLADEDS
SYLDEAASAPAIPEGVPTDTKNKDGVLVDEFGLPQIPAS
NT seq 660 nt   +upstreamnt  +downstreamnt
atgaaccgactcttcgggaaagcgaaacccaaggctccgccgcccagcctgactgactgc
attggcacggtggacagtagagcagaatccattgacaagaagatttctcgattggatgct
gagctagtgaagtataaggatcagatcaagaagatgagagagggtcctgcaaagaatatg
gtcaagcagaaagccttgcgagttttaaagcaaaagaggatgtatgagcagcagcgggac
aatcttgcccaacagtcattcaacatggaacaagccaattataccatccagtctttgaag
gacaccaagaccacggttgatgctatgaaactgggagtaaaggaaatgaagaaggcatac
aagcaagtgaagatcgaccagattgaggatttacaagaccagctagaggatatgatggaa
gatgcaaatgaaatccaagaagcactgagtcgcagttatggcaccccagaactggatgaa
gatgatttagaagcagagttggatgcactaggtgatgagcttctggctgatgaagacagt
tcttatttggatgaggcagcatctgcacctgcaattccagaaggtgttcccactgataca
aaaaacaaggatggagttctggtggatgaatttggattgccacagatccctgcttcatag

KEGG   Homo sapiens (human): 51652
Entry
51652             CDS       T01001                                 
Symbol
CHMP3, CGI-149, NEDF, VPS24
Name
(RefSeq) charged multivesicular body protein 3
  KO
K12193  charged multivesicular body protein 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    51652 (CHMP3)
  09143 Cell growth and death
   04217 Necroptosis
    51652 (CHMP3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    51652 (CHMP3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    51652 (CHMP3)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-III complex
    51652 (CHMP3)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   51652 (CHMP3)
SSDB
Motif
Pfam: Snf7 AAA_6 DUF3915 zf-ZPR1
Other DBs
NCBI-GeneID: 51652
NCBI-ProteinID: NP_057163
OMIM: 610052
HGNC: 29865
Ensembl: ENSG00000115561
Pharos: Q9Y3E7(Tbio)
UniProt: Q9Y3E7
Structure
LinkDB
Position
2:complement(86503430..86563443)
AA seq 222 aa
MGLFGKTQEKPPKELVNEWSLKIRKEMRVVDRQIRDIQREEEKVKRSVKDAAKKGQKDVC
IVLAKEMIRSRKAVSKLYASKAHMNSVLMGMKNQLAVLRVAGSLQKSTEVMKAMQSLVKI
PEIQATMRELSKEMMKAGIIEEMLEDTFESMDDQEEMEEEAEMEIDRILFEITAGALGKA
PSKVTDALPEPEPPGAMAASEDEEEEEEALEAMQSRLATLRS
NT seq 669 nt   +upstreamnt  +downstreamnt
atggggctgtttggaaagacccaggagaagccgcccaaagaactggtcaatgagtggtca
ttgaagataagaaaggaaatgagagttgttgacaggcaaataagggatatccaaagagaa
gaagaaaaagtgaaacgatctgtgaaagatgctgccaagaagggccagaaggatgtctgc
atagttctggccaaggagatgatcaggtcaaggaaggctgtgagcaagctgtatgcatcc
aaagcacacatgaactcagtgctcatggggatgaagaaccagctcgcggtcttgcgagtg
gctggttccctgcagaagagcacagaagtgatgaaggccatgcaaagtcttgtgaagatt
ccagagattcaggccaccatgagggagttgtccaaagaaatgatgaaggctgggatcata
gaggagatgttagaggacacttttgaaagcatggacgatcaggaagaaatggaggaagaa
gcagaaatggaaattgacagaattctctttgaaattacagcaggggccttgggcaaagca
cccagtaaagtgactgatgcccttccagagccagaacctccaggagcgatggctgcctca
gaggatgaggaggaggaggaagaggctctggaggccatgcagtcccggctggccacactc
cgcagctag

KEGG   Homo sapiens (human): 57132
Entry
57132             CDS       T01001                                 
Symbol
CHMP1B, C10orf2, C18-ORF2, C18orf2, CHMP1.5, Vps46-2, Vps46B, hVps46-2
Name
(RefSeq) charged multivesicular body protein 1B
  KO
K12197  charged multivesicular body protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    57132 (CHMP1B)
  09143 Cell growth and death
   04217 Necroptosis
    57132 (CHMP1B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    57132 (CHMP1B)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    57132 (CHMP1B)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-III complex
    57132 (CHMP1B)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   57132 (CHMP1B)
  Exosomal proteins of other body fluids (saliva and urine)
   57132 (CHMP1B)
  Exosomal proteins of colorectal cancer cells
   57132 (CHMP1B)
SSDB
Motif
Pfam: Snf7 Ist1 FlxA Mu-like_Pro Mt_ATP-synt_D DUF948
Other DBs
NCBI-GeneID: 57132
NCBI-ProteinID: NP_065145
OMIM: 606486
HGNC: 24287
Ensembl: ENSG00000255112
Pharos: Q7LBR1(Tbio)
UniProt: Q7LBR1
Structure
LinkDB
Position
18:11851413..11854444
AA seq 199 aa
MSNMEKHLFNLKFAAKELSRSAKKCDKEEKAEKAKIKKAIQKGNMEVARIHAENAIRQKN
QAVNFLRMSARVDAVAARVQTAVTMGKVTKSMAGVVKSMDATLKTMNLEKISALMDKFEH
QFETLDVQTQQMEDTMSSTTTLTTPQNQVDMLLQEMADEAGLDLNMELPQGQTGSVGTSV
ASAEQDELSQRLARLRDQV
NT seq 600 nt   +upstreamnt  +downstreamnt
atgtctaacatggagaaacacctgttcaacctgaagttcgcggccaaagaactgagtagg
agtgccaaaaaatgcgataaggaggaaaaggccgaaaaggccaaaattaaaaaggccatt
cagaagggcaacatggaagttgcgaggatacacgccgaaaatgccatccgccagaagaac
caggcggtgaatttcttgagaatgagtgcgcgagtcgatgcagtggctgccagggtccag
acggcggtgacgatgggcaaggtgaccaagtcgatggctggtgtggttaagtcgatggat
gcgacattgaagaccatgaatctggagaagatttctgctttgatggacaaattcgagcac
cagtttgagactctggacgtccagacgcagcaaatggaagacacgatgagcagcacgacg
acgctcaccactccccagaaccaagtggatatgctgctccaggaaatggcagatgaggcg
ggcctcgacctcaacatggagctgccgcagggccagaccggctccgtgggcacgagcgtg
gcttcggcggagcaggatgaactgtctcagagactggcccgccttcgggatcaagtgtga

DBGET integrated database retrieval system