KEGG   Homo sapiens (human): 100529063
Entry
100529063         CDS       T01001                                 
Symbol
BCL2L2-PABPN1
Name
(RefSeq) BCL2L2-PABPN1 readthrough
  KO
K14396  polyadenylate-binding protein 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa03015  mRNA surveillance pathway
hsa05164  Influenza A
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    100529063 (BCL2L2-PABPN1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    100529063 (BCL2L2-PABPN1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    100529063 (BCL2L2-PABPN1)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Other transport factors
     100529063 (BCL2L2-PABPN1)
SSDB
Motif
Pfam: Bcl-2 RRM_1 BH4 Seryl_tRNA_N HTH_AsnC-type
Other DBs
NCBI-GeneID: 100529063
NCBI-ProteinID: NP_001186793
HGNC: 42959
Ensembl: ENSG00000258643
Vega: OTTHUMG00000171498
LinkDB
Position
14:23306833..23326163
AA seq 333 aa
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRT
FSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVG
QVQEWMVAYLETQLADWIHSSGGWELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPP
GNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPK
GFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPRARYRARTTNY
NSSRSRFYSGFNSRPRGRVYRGRARATSWYSPY
NT seq 1002 nt   +upstreamnt  +downstreamnt
atggcgaccccagcctcggccccagacacacgggctctggtggcagactttgtaggttat
aagctgaggcagaagggttatgtctgtggagctggccccggggagggcccagcagctgac
ccgctgcaccaagccatgcgggcagctggagatgagttcgagacccgcttccggcgcacc
ttctctgatctggcggctcagctgcatgtgaccccaggctcagcccaacaacgcttcacc
caggtctccgatgaactttttcaagggggccccaactggggccgccttgtagccttcttt
gtctttggggctgcactgtgtgctgagagtgtcaacaaggagatggaaccactggtggga
caagtgcaggagtggatggtggcctacctggagacgcagctggctgactggatccacagc
agtgggggctgggagctggaagctatcaaagctcgagtcagggagatggaggaagaagct
gagaagctaaaggagctacagaacgaggtagagaagcagatgaatatgagtccacctcca
ggcaatgctggcccggtgatcatgtccattgaggagaagatggaggctgatgcccgttcc
atctatgttggcaatgtggactatggtgcaacagcagaagagctggaagctcactttcat
ggctgtggttcagtcaaccgtgttaccatactgtgtgacaaatttagtggccatcccaaa
gggtttgcgtatatagagttctcagacaaagagtcagtgaggacttccttggccttagat
gagtccctatttagaggaaggcaaatcaaggtgatcccaaaacgaaccaacagaccaggc
atcagcacaacagaccggggttttccacgagcccgctaccgcgcccggaccaccaactac
aacagctcccgctctcgattctacagtggttttaacagcaggccccggggtcgcgtctac
aggggccgggctagagcgacatcatggtattccccttactaa

KEGG   Homo sapiens (human): 390748
Entry
390748            CDS       T01001                                 
Symbol
PABPN1L, PABPNL1, ePABP2
Name
(RefSeq) PABPN1 like, cytoplasmic
  KO
K14396  polyadenylate-binding protein 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa03015  mRNA surveillance pathway
hsa05164  Influenza A
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    390748 (PABPN1L)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    390748 (PABPN1L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    390748 (PABPN1L)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Other transport factors
     390748 (PABPN1L)
SSDB
Motif
Pfam: RRM_1
Other DBs
NCBI-GeneID: 390748
NCBI-ProteinID: NP_001073956
HGNC: 37237
Ensembl: ENSG00000205022
Vega: OTTHUMG00000170127
Pharos: A6NDY0(Tdark)
UniProt: A6NDY0 B6RF28
LinkDB
Position
16:complement(88863333..88870135)
AA seq 278 aa
MWPFPSRSLFPPPTQAWLQTVSSDPEAQGWGAWNETKEILGPEGGEGKEEKEEEEDAEED
QDGDAGFLLSLLEQENLAECPLPDQELEAIKMKVCAMEQAEGTPRPPGVQQQAEEEEGTA
AGQLLSPETVGCPLSGTPEEKVEADHRSVYVGNVDYGGSAEELEAHFSRCGEVHRVTILC
DKFSGHPKGYAYIEFATKGSVQAAVELDQSLFRGRVIKVLPKRTNFPGISSTDRGGLRGH
PGSRGAPFPHSGLQGRPRLRPQGQNRARGKFSPWFSPY
NT seq 837 nt   +upstreamnt  +downstreamnt
atgtggcccttcccgagccgctctctcttcccacccccgactcaggcctggctccagacg
gtctcctcagaccctgaggcccagggctggggggcctggaacgagaccaaggagattctg
gggccagagggtggggaagggaaggaggagaaagaggaggaagaggatgcagaggaagac
caggatggggatgcaggctttctgctgtctctgctggagcaagagaacctggctgagtgc
ccattgcctgaccaggagctggaggccatcaagatgaaggtgtgtgccatggagcaggcc
gaggggacgccacggcctccaggagtgcagcaacaggccgaggaagaggagggcaccgcg
gccgggcagctgctgagccctgagaccgtgggctgccccctctctgggacccccgaggag
aaggtggaggctgaccacagatccgtctacgtgggcaacgtggactacgggggctccgcc
gaggagctggaggcccacttcagccgctgtggggaggtccaccgagtcacgatcctgtgt
gacaagttctctggacaccccaagggttatgcctacatagagtttgccaccaagggctcc
gtgcaggccgccgtggagctggaccagagcctcttccggggccgggtcatcaaggtgctg
ccgaaaagaaccaacttccctgggatcagctccacagaccgcgggggccttcgaggacac
ccaggctccaggggggcacccttcccccacagcggcctccagggcaggccccggctcaga
ccacaagggcagaaccgggcccgtggaaaattctcaccatggttttcaccgtattaa

KEGG   Homo sapiens (human): 8106
Entry
8106              CDS       T01001                                 
Symbol
PABPN1, OPMD, PAB2, PABII, PABP-2, PABP2
Name
(RefSeq) poly(A) binding protein nuclear 1
  KO
K14396  polyadenylate-binding protein 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa03015  mRNA surveillance pathway
hsa05164  Influenza A
Disease
H00704  Oculopharyngeal muscular dystrophy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    8106 (PABPN1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    8106 (PABPN1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    8106 (PABPN1)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Other transport factors
     8106 (PABPN1)
SSDB
Motif
Pfam: RRM_1 Seryl_tRNA_N
Other DBs
NCBI-GeneID: 8106
NCBI-ProteinID: NP_004634
OMIM: 602279
HGNC: 8565
Ensembl: ENSG00000100836
Vega: OTTHUMG00000028739
Pharos: Q86U42(Tbio)
UniProt: Q86U42
Structure
LinkDB
Position
14:23321457..23326163
AA seq 306 aa
MAAAAAAAAAAGAAGGRGSGPGRRRHLVPGAGGEAGEGAPGGAGDYGNGLESEELEPEEL
LLEPEPEPEPEEEPPRPRAPPGAPGPGPGSGAPGSQEEEEEPGLVEGDPGDGAIEDPELE
AIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVD
YGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGR
QIKVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARAT
SWYSPY
NT seq 921 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggcggcggcagcagcagcgggggctgcgggcggtcggggctccggg
ccggggcggcggcgccatcttgtgcccggggccggtggggaggccggggagggggccccg
gggggcgcaggggactacgggaacggcctggagtctgaggaactggagcctgaggagctg
ctgctggagcccgagccggagcccgagcccgaagaggagccgccccggccccgcgccccc
ccgggagctccgggccctgggcctggttcgggagcccccggcagccaagaggaggaggag
gagccgggactggtcgagggtgacccgggggacggcgccattgaggacccggagctggaa
gctatcaaagctcgagtcagggagatggaggaagaagctgagaagctaaaggagctacag
aacgaggtagagaagcagatgaatatgagtccacctccaggcaatgctggcccggtgatc
atgtccattgaggagaagatggaggctgatgcccgttccatctatgttggcaatgtggac
tatggtgcaacagcagaagagctggaagctcactttcatggctgtggttcagtcaaccgt
gttaccatactgtgtgacaaatttagtggccatcccaaagggtttgcgtatatagagttc
tcagacaaagagtcagtgaggacttccttggccttagatgagtccctatttagaggaagg
caaatcaaggtgatcccaaaacgaaccaacagaccaggcatcagcacaacagaccggggt
tttccacgagcccgctaccgcgcccggaccaccaactacaacagctcccgctctcgattc
tacagtggttttaacagcaggccccggggtcgcgtctacaggggccgggctagagcgaca
tcatggtattccccttactaa

DBGET integrated database retrieval system