KEGG   Homo sapiens (human): 100532726
Entry
100532726         CDS       T01001                                 
Symbol
NDUFC2-KCTD14
Name
(RefSeq) NDUFC2-KCTD14 readthrough
  KO
K03968  NADH dehydrogenase (ubiquinone) 1 subunit C2
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04714  Thermogenesis
hsa04723  Retrograde endocannabinoid signaling
hsa04932  Non-alcoholic fatty liver disease
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05208  Chemical carcinogenesis - reactive oxygen species
hsa05415  Diabetic cardiomyopathy
Module
hsa_M00147  NADH dehydrogenase (ubiquinone) 1 beta subcomplex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    100532726 (NDUFC2-KCTD14)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    100532726 (NDUFC2-KCTD14)
  09159 Environmental adaptation
   04714 Thermogenesis
    100532726 (NDUFC2-KCTD14)
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    100532726 (NDUFC2-KCTD14)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100532726 (NDUFC2-KCTD14)
   05012 Parkinson disease
    100532726 (NDUFC2-KCTD14)
   05014 Amyotrophic lateral sclerosis
    100532726 (NDUFC2-KCTD14)
   05016 Huntington disease
    100532726 (NDUFC2-KCTD14)
   05020 Prion disease
    100532726 (NDUFC2-KCTD14)
   05022 Pathways of neurodegeneration - multiple diseases
    100532726 (NDUFC2-KCTD14)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    100532726 (NDUFC2-KCTD14)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100532726 (NDUFC2-KCTD14)
SSDB
Motif
Pfam: NDUF_C2
Other DBs
NCBI-GeneID: 100532726
NCBI-ProteinID: NP_001190190
HGNC: 42956
Ensembl: ENSG00000259112
Pharos: E9PQ53(Tdark)
UniProt: E9PQ53
LinkDB
Position
11:complement(78015715..78079862)
AA seq 114 aa
MIARRNPEPLRFLPDEARSLPPPKLTDPRLLYIGFLGYCSGLIDNLIRRRPIATAGLHRQ
LLYITAFFFAGYYLVKREDYLYAVRDREMFGYMKLHPEDFPEEDVYCCGAERRG
NT seq 345 nt   +upstreamnt  +downstreamnt
atgatcgcacggcggaacccagaacccttacggtttctgccggatgaggcccggagcctg
cccccgcccaagctgaccgacccgcggctcctctacatcggcttcttgggctactgctcc
ggcctgattgataacctaatccggcggaggccgatcgcgacggctggtttgcatcgccag
cttctatatattacggcctttttttttgctggatattatcttgtaaaacgtgaagactac
ctgtatgctgtgagggaccgtgaaatgtttggatatatgaaattacatccagaggatttt
cctgaagaagatgtctactgttgtggagctgaacgtcgggggtga

KEGG   Homo sapiens (human): 126328
Entry
126328            CDS       T01001                                 
Symbol
NDUFA11, B14.7, CI-B14.7, MC1DN14
Name
(RefSeq) NADH:ubiquinone oxidoreductase subunit A11
  KO
K03956  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 11
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04714  Thermogenesis
hsa04723  Retrograde endocannabinoid signaling
hsa04932  Non-alcoholic fatty liver disease
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05208  Chemical carcinogenesis - reactive oxygen species
hsa05415  Diabetic cardiomyopathy
Module
hsa_M00146  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
Network
nt06418  Oxidative phosphorylation
nt06460  Alzheimer disease
nt06463  Parkinson disease
nt06464  Amyotrophic lateral sclerosis
  Element
N00995  Electron transfer in Complex I
N00997  Mutation-caused aberrant Abeta to electron transfer in Complex I
N01042  Mutation-caused aberrant SNCA to electron transfer in Complex I
N01043  Mutation-inactivated PINK1 to electron transfer in Complex I
N01044  MPP+ to electron transfer in Complex I
N01045  Rotenone to electron transfer in Complex I
N01136  Mutation-caused aberrant TDP43 to electron transfer in Complex I
Disease
H00473  Mitochondrial complex I deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    126328 (NDUFA11)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    126328 (NDUFA11)
  09159 Environmental adaptation
   04714 Thermogenesis
    126328 (NDUFA11)
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    126328 (NDUFA11)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    126328 (NDUFA11)
   05012 Parkinson disease
    126328 (NDUFA11)
   05014 Amyotrophic lateral sclerosis
    126328 (NDUFA11)
   05016 Huntington disease
    126328 (NDUFA11)
   05020 Prion disease
    126328 (NDUFA11)
   05022 Pathways of neurodegeneration - multiple diseases
    126328 (NDUFA11)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    126328 (NDUFA11)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    126328 (NDUFA11)
SSDB
Motif
Pfam: Tim17 DUF6457
Other DBs
NCBI-GeneID: 126328
NCBI-ProteinID: NP_783313
OMIM: 612638
HGNC: 20371
Ensembl: ENSG00000174886
Pharos: Q86Y39(Tclin)
UniProt: Q86Y39
Structure
LinkDB
Position
19:complement(5891229..5903790)
AA seq 141 aa
MAPKVFRQYWDIPDGTDCHRKAYSTTSIASVAGLTAAAYRVTLNPPGTFLEGVAKVGQYT
FTAAAVGAVFGLTTCISAHVREKPDDPLNYFLGGCAGGLTLGARTHNYGIGAAACVYFGI
AASLVKMGRLEGWEVFAKPKV
NT seq 426 nt   +upstreamnt  +downstreamnt
atggcgccgaaggtttttcgtcagtactgggatatccccgatggcaccgattgccaccgc
aaagcctacagcaccaccagtattgccagcgtcgctggcctgaccgccgctgcctacaga
gtcacactcaatcctccgggcaccttccttgaaggagtggctaaggttggacaatacacg
ttcactgcagctgctgtcggggccgtgtttggcctcaccacctgcatcagcgcccatgtc
cgcgagaagcccgacgaccccctgaactacttcctcggtggctgcgccggaggcctgact
ctgggagcacgcacgcacaactacgggattggcgccgccgcctgcgtgtactttggcata
gcggcctccctggtcaagatgggccggctggagggctgggaggtgtttgcaaaacccaag
gtgtga

KEGG   Homo sapiens (human): 374291
Entry
374291            CDS       T01001                                 
Symbol
NDUFS7, CI-20, CI-20KD, MC1DN3, MY017, PSST
Name
(RefSeq) NADH:ubiquinone oxidoreductase core subunit S7
  KO
K03940  NADH dehydrogenase (ubiquinone) Fe-S protein 7 [EC:7.1.1.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04714  Thermogenesis
hsa04723  Retrograde endocannabinoid signaling
hsa04932  Non-alcoholic fatty liver disease
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05208  Chemical carcinogenesis - reactive oxygen species
hsa05415  Diabetic cardiomyopathy
Module
hsa_M00143  NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Network
nt06418  Oxidative phosphorylation
nt06460  Alzheimer disease
nt06463  Parkinson disease
nt06464  Amyotrophic lateral sclerosis
  Element
N00995  Electron transfer in Complex I
N00997  Mutation-caused aberrant Abeta to electron transfer in Complex I
N01042  Mutation-caused aberrant SNCA to electron transfer in Complex I
N01043  Mutation-inactivated PINK1 to electron transfer in Complex I
N01044  MPP+ to electron transfer in Complex I
N01045  Rotenone to electron transfer in Complex I
N01136  Mutation-caused aberrant TDP43 to electron transfer in Complex I
Disease
H00473  Mitochondrial complex I deficiency
H01354  Leigh syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    374291 (NDUFS7)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    374291 (NDUFS7)
  09159 Environmental adaptation
   04714 Thermogenesis
    374291 (NDUFS7)
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    374291 (NDUFS7)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    374291 (NDUFS7)
   05012 Parkinson disease
    374291 (NDUFS7)
   05014 Amyotrophic lateral sclerosis
    374291 (NDUFS7)
   05016 Huntington disease
    374291 (NDUFS7)
   05020 Prion disease
    374291 (NDUFS7)
   05022 Pathways of neurodegeneration - multiple diseases
    374291 (NDUFS7)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    374291 (NDUFS7)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    374291 (NDUFS7)
Enzymes [BR:hsa01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     374291 (NDUFS7)
SSDB
Motif
Pfam: Oxidored_q6 Secapin
Other DBs
NCBI-GeneID: 374291
NCBI-ProteinID: NP_077718
OMIM: 601825
HGNC: 7714
Ensembl: ENSG00000115286
Pharos: O75251(Tclin)
UniProt: O75251 Q7LD69
Structure
LinkDB
Position
19:1383907..1395584
AA seq 213 aa
MAVLSAPGLRGFRILGLRSSVGPAVQARGVHQSVATDGPSSTQPALPKARAVAPKPSSRG
EYVVAKLDDLVNWARRSSLWPMTFGLACCAVEMMHMAAPRYDMDRFGVVFRASPRQSDVM
IVAGTLTNKMAPALRKVYDQMPEPRYVVSMGSCANGGGYYHYSYSVVRGCDRIVPVDIYI
PGCPPTAEALLYGILQLQRKIKRERRLQIWYRR
NT seq 642 nt   +upstreamnt  +downstreamnt
atggcggtgctgtcagctcctggcctgcgcggcttccggatccttggtctgcgctccagc
gtgggcccggctgtgcaggcacgaggtgtccatcagagcgtggccaccgatggcccaagc
agcacccagcctgccctgccaaaggccagagccgtggctcccaaacccagcagccggggc
gagtatgtggtggccaagctggatgacctcgtcaactgggcccgccggagttctctgtgg
cccatgaccttcggcctggcctgctgcgccgtggagatgatgcacatggcagcaccccgc
tacgacatggaccgctttggcgtggtcttccgcgccagcccgcgccagtccgacgtcatg
atcgtggccggcacactcaccaacaagatggccccagcgcttcgcaaggtctacgaccag
atgccggagccgcgctacgtggtctccatggggagctgcgccaacggaggaggctactac
cactattcctactcggtggtgaggggctgcgaccgcatcgtgcccgtggacatctacatc
ccaggctgcccacctacggccgaggccctgctctacggcatcctgcagctgcagaggaag
atcaagcgggagcggaggctgcagatctggtaccgcaggtag

KEGG   Homo sapiens (human): 4694
Entry
4694              CDS       T01001                                 
Symbol
NDUFA1, CI-MWFE, MC1DN12, MWFE, ZNF183
Name
(RefSeq) NADH:ubiquinone oxidoreductase subunit A1
  KO
K03945  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04714  Thermogenesis
hsa04723  Retrograde endocannabinoid signaling
hsa04932  Non-alcoholic fatty liver disease
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05208  Chemical carcinogenesis - reactive oxygen species
hsa05415  Diabetic cardiomyopathy
Module
hsa_M00146  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
Network
nt06418  Oxidative phosphorylation
nt06460  Alzheimer disease
nt06463  Parkinson disease
nt06464  Amyotrophic lateral sclerosis
  Element
N00995  Electron transfer in Complex I
N00997  Mutation-caused aberrant Abeta to electron transfer in Complex I
N01042  Mutation-caused aberrant SNCA to electron transfer in Complex I
N01043  Mutation-inactivated PINK1 to electron transfer in Complex I
N01044  MPP+ to electron transfer in Complex I
N01045  Rotenone to electron transfer in Complex I
N01136  Mutation-caused aberrant TDP43 to electron transfer in Complex I
Disease
H00473  Mitochondrial complex I deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    4694 (NDUFA1)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    4694 (NDUFA1)
  09159 Environmental adaptation
   04714 Thermogenesis
    4694 (NDUFA1)
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    4694 (NDUFA1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    4694 (NDUFA1)
   05012 Parkinson disease
    4694 (NDUFA1)
   05014 Amyotrophic lateral sclerosis
    4694 (NDUFA1)
   05016 Huntington disease
    4694 (NDUFA1)
   05020 Prion disease
    4694 (NDUFA1)
   05022 Pathways of neurodegeneration - multiple diseases
    4694 (NDUFA1)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    4694 (NDUFA1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    4694 (NDUFA1)
SSDB
Motif
Pfam: MWFE
Other DBs
NCBI-GeneID: 4694
NCBI-ProteinID: NP_004532
OMIM: 300078
HGNC: 7683
Ensembl: ENSG00000125356
Pharos: O15239(Tclin)
UniProt: O15239 Q6IBB5
Structure
LinkDB
Position
X:119871832..119876662
AA seq 70 aa
MWFEILPGLSVMGVCLLIPGLATAYIHRFTNGGKEKRVAHFGYHWSLMERDRRISGVDRY
YVSKGLENID
NT seq 213 nt   +upstreamnt  +downstreamnt
atgtggttcgagattctccccggactctccgtcatgggcgtgtgcttgttgattccagga
ctggctactgcgtacatccacaggttcactaacgggggcaaggaaaaaagggttgctcat
tttgggtatcactggagtctgatggaaagagataggcgcatctctggagttgatcgttac
tatgtgtcaaagggtttggagaacattgattaa

KEGG   Homo sapiens (human): 4695
Entry
4695              CDS       T01001                                 
Symbol
NDUFA2, B8, CD14, CIB8, MC1DN13
Name
(RefSeq) NADH:ubiquinone oxidoreductase subunit A2
  KO
K03946  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04714  Thermogenesis
hsa04723  Retrograde endocannabinoid signaling
hsa04932  Non-alcoholic fatty liver disease
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05208  Chemical carcinogenesis - reactive oxygen species
hsa05415  Diabetic cardiomyopathy
Module
hsa_M00146  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
Network
nt06418  Oxidative phosphorylation
nt06460  Alzheimer disease
nt06463  Parkinson disease
nt06464  Amyotrophic lateral sclerosis
  Element
N00995  Electron transfer in Complex I
N00997  Mutation-caused aberrant Abeta to electron transfer in Complex I
N01042  Mutation-caused aberrant SNCA to electron transfer in Complex I
N01043  Mutation-inactivated PINK1 to electron transfer in Complex I
N01044  MPP+ to electron transfer in Complex I
N01045  Rotenone to electron transfer in Complex I
N01136  Mutation-caused aberrant TDP43 to electron transfer in Complex I
Disease
H00473  Mitochondrial complex I deficiency
H01354  Leigh syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    4695 (NDUFA2)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    4695 (NDUFA2)
  09159 Environmental adaptation
   04714 Thermogenesis
    4695 (NDUFA2)
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    4695 (NDUFA2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    4695 (NDUFA2)
   05012 Parkinson disease
    4695 (NDUFA2)
   05014 Amyotrophic lateral sclerosis
    4695 (NDUFA2)
   05016 Huntington disease
    4695 (NDUFA2)
   05020 Prion disease
    4695 (NDUFA2)
   05022 Pathways of neurodegeneration - multiple diseases
    4695 (NDUFA2)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    4695 (NDUFA2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    4695 (NDUFA2)
SSDB
Motif
Pfam: L51_S25_CI-B8
Other DBs
NCBI-GeneID: 4695
NCBI-ProteinID: NP_002479
OMIM: 602137
HGNC: 7685
Ensembl: ENSG00000131495
Pharos: O43678(Tclin)
UniProt: O43678
Structure
LinkDB
Position
5:complement(140645285..140647630)
AA seq 99 aa
MAAAAASRGVGAKLGLREIRIHLCQRSPGSQGVRDFIEKRYVELKKANPDLPILIRECSD
VQPKLWARYAFGQETNVPLNNFSADQVTRALENVLSGKA
NT seq 300 nt   +upstreamnt  +downstreamnt
atggcggcggccgcagcaagtcgaggagtcggggcaaagctgggcctgcgtgagattcgc
atccacttatgtcagcgctcgcccggcagccagggcgtcagggacttcattgagaaacgc
tacgtggagctgaagaaggcgaatcccgacctacccatcctaatccgcgaatgctccgat
gtgcagcccaagctctgggcccgctacgcatttggccaagagacgaatgtccctttgaac
aacttcagtgctgatcaggtaaccagagccctggagaacgttctaagtggtaaagcctga

KEGG   Homo sapiens (human): 4696
Entry
4696              CDS       T01001                                 
Symbol
NDUFA3, B9, CI-B9
Name
(RefSeq) NADH:ubiquinone oxidoreductase subunit A3
  KO
K03947  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04714  Thermogenesis
hsa04723  Retrograde endocannabinoid signaling
hsa04932  Non-alcoholic fatty liver disease
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05208  Chemical carcinogenesis - reactive oxygen species
hsa05415  Diabetic cardiomyopathy
Module
hsa_M00146  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
Network
nt06418  Oxidative phosphorylation
nt06460  Alzheimer disease
nt06463  Parkinson disease
nt06464  Amyotrophic lateral sclerosis
  Element
N00995  Electron transfer in Complex I
N00997  Mutation-caused aberrant Abeta to electron transfer in Complex I
N01042  Mutation-caused aberrant SNCA to electron transfer in Complex I
N01043  Mutation-inactivated PINK1 to electron transfer in Complex I
N01044  MPP+ to electron transfer in Complex I
N01045  Rotenone to electron transfer in Complex I
N01136  Mutation-caused aberrant TDP43 to electron transfer in Complex I
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    4696 (NDUFA3)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    4696 (NDUFA3)
  09159 Environmental adaptation
   04714 Thermogenesis
    4696 (NDUFA3)
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    4696 (NDUFA3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    4696 (NDUFA3)
   05012 Parkinson disease
    4696 (NDUFA3)
   05014 Amyotrophic lateral sclerosis
    4696 (NDUFA3)
   05016 Huntington disease
    4696 (NDUFA3)
   05020 Prion disease
    4696 (NDUFA3)
   05022 Pathways of neurodegeneration - multiple diseases
    4696 (NDUFA3)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    4696 (NDUFA3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    4696 (NDUFA3)
SSDB
Motif
Pfam: NADHdh_A3
Other DBs
NCBI-GeneID: 4696
NCBI-ProteinID: NP_004533
OMIM: 603832
HGNC: 7686
Ensembl: ENSG00000170906
Pharos: O95167(Tclin)
UniProt: O95167 Q6FGG4
Structure
LinkDB
Position
19:54102855..54107568
AA seq 84 aa
MAARVGAFLKNAWDKEPVLVVSFVVGGLAVILPPLSPYFKYSVMINKATPYNYPVPVRDD
GNMPDVPSHPQDPQGPSLEWLKKL
NT seq 255 nt   +upstreamnt  +downstreamnt
atggctgcgagagtcggcgccttcctcaagaatgcctgggacaaggagccagtgctggtc
gtgtccttcgtcgtcgggggcctcgctgtaattctgcccccattgagcccctacttcaag
tactccgtcatgatcaacaaggccacgccctacaactacccagtgcccgtccgtgatgat
gggaacatgcccgacgtgcccagccacccccaggaccctcagggccccagcctggagtgg
ctgaagaaactgtga

KEGG   Homo sapiens (human): 4697
Entry
4697              CDS       T01001                                 
Symbol
NDUFA4, CI-9k, CI-MLRQ, COXFA4, MC4DN21, MISTR1, MLRQ, MRCAF1
Name
(RefSeq) NDUFA4 mitochondrial complex associated
  KO
K03948  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04714  Thermogenesis
hsa04723  Retrograde endocannabinoid signaling
hsa04932  Non-alcoholic fatty liver disease
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05208  Chemical carcinogenesis - reactive oxygen species
hsa05415  Diabetic cardiomyopathy
Module
hsa_M00146  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
Network
nt06418  Oxidative phosphorylation
nt06460  Alzheimer disease
nt06463  Parkinson disease
nt06464  Amyotrophic lateral sclerosis
  Element
N00995  Electron transfer in Complex I
N00997  Mutation-caused aberrant Abeta to electron transfer in Complex I
N01042  Mutation-caused aberrant SNCA to electron transfer in Complex I
N01043  Mutation-inactivated PINK1 to electron transfer in Complex I
N01044  MPP+ to electron transfer in Complex I
N01045  Rotenone to electron transfer in Complex I
N01136  Mutation-caused aberrant TDP43 to electron transfer in Complex I
Disease
H01368  Cytochrome c oxidase (COX) deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    4697 (NDUFA4)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    4697 (NDUFA4)
  09159 Environmental adaptation
   04714 Thermogenesis
    4697 (NDUFA4)
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    4697 (NDUFA4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    4697 (NDUFA4)
   05012 Parkinson disease
    4697 (NDUFA4)
   05014 Amyotrophic lateral sclerosis
    4697 (NDUFA4)
   05016 Huntington disease
    4697 (NDUFA4)
   05020 Prion disease
    4697 (NDUFA4)
   05022 Pathways of neurodegeneration - multiple diseases
    4697 (NDUFA4)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    4697 (NDUFA4)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    4697 (NDUFA4)
SSDB
Motif
Pfam: B12D
Other DBs
NCBI-GeneID: 4697
NCBI-ProteinID: NP_002480
OMIM: 603833
HGNC: 7687
Ensembl: ENSG00000189043
Pharos: O00483(Tclin)
UniProt: O00483 A0A024R9Z0
Structure
LinkDB
Position
7:complement(10931943..10940153)
AA seq 81 aa
MLRQIIGQAKKHPSLIPLFVFIGTGATGATLYLLRLALFNPDVCWDRNNPEPWNKLGPND
QYKFYSVNVDYSKLKKERPDF
NT seq 246 nt   +upstreamnt  +downstreamnt
atgctccgccagatcatcggtcaggccaagaagcatccgagcttgatccccctctttgta
tttattggaactggagctactggagcaacactgtatctcttgcgtctggcattgttcaat
ccagatgtttgttgggacagaaataacccagagccctggaacaaactgggtcccaatgat
caatacaagttctactcagtgaatgtggattacagcaagctgaagaaggaacgtccagat
ttctaa

KEGG   Homo sapiens (human): 4698
Entry
4698              CDS       T01001                                 
Symbol
NDUFA5, B13, CI-13KD-B, CI-13kB, NUFM, UQOR13
Name
(RefSeq) NADH:ubiquinone oxidoreductase subunit A5
  KO
K03949  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04714  Thermogenesis
hsa04723  Retrograde endocannabinoid signaling
hsa04932  Non-alcoholic fatty liver disease
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05208  Chemical carcinogenesis - reactive oxygen species
hsa05415  Diabetic cardiomyopathy
Module
hsa_M00146  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
Network
nt06418  Oxidative phosphorylation
nt06460  Alzheimer disease
nt06463  Parkinson disease
nt06464  Amyotrophic lateral sclerosis
  Element
N00995  Electron transfer in Complex I
N00997  Mutation-caused aberrant Abeta to electron transfer in Complex I
N01042  Mutation-caused aberrant SNCA to electron transfer in Complex I
N01043  Mutation-inactivated PINK1 to electron transfer in Complex I
N01044  MPP+ to electron transfer in Complex I
N01045  Rotenone to electron transfer in Complex I
N01136  Mutation-caused aberrant TDP43 to electron transfer in Complex I
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    4698 (NDUFA5)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    4698 (NDUFA5)
  09159 Environmental adaptation
   04714 Thermogenesis
    4698 (NDUFA5)
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    4698 (NDUFA5)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    4698 (NDUFA5)
   05012 Parkinson disease
    4698 (NDUFA5)
   05014 Amyotrophic lateral sclerosis
    4698 (NDUFA5)
   05016 Huntington disease
    4698 (NDUFA5)
   05020 Prion disease
    4698 (NDUFA5)
   05022 Pathways of neurodegeneration - multiple diseases
    4698 (NDUFA5)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    4698 (NDUFA5)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    4698 (NDUFA5)
SSDB
Motif
Pfam: ETC_C1_NDUFA5 Methyltransf_16
Other DBs
NCBI-GeneID: 4698
NCBI-ProteinID: NP_001269349
OMIM: 601677
HGNC: 7688
Ensembl: ENSG00000128609
Pharos: Q16718(Tclin)
UniProt: Q16718
Structure
LinkDB
Position
7:complement(123536997..123601651)
AA seq 116 aa
MPYRVGQTTGLVGLAVCNTPHERLRILYTKILDVLEEIPKNAAYRKYTEQITNEKLAMVK
AEPDVKKLEDQLQGGQLEEVILQAEHELNLARKMREWKLWEPLVEEPPADQWKWPI
NT seq 351 nt   +upstreamnt  +downstreamnt
atgccttaccgggtagggcagaccactggccttgtgggattggctgtgtgcaatactcct
cacgagaggctaagaatattgtacacaaagattcttgatgttcttgaggaaatccctaaa
aatgcagcatatagaaagtatacagaacagattacaaatgagaagctggctatggttaaa
gcggaaccagatgttaaaaaattagaagaccaacttcaaggcggtcaattagaagaggtg
attcttcaggctgaacatgaactaaatctggcaagaaaaatgagggaatggaaactatgg
gagccattagtggaagagcctcctgccgatcagtggaaatggccaatataa

KEGG   Homo sapiens (human): 4700
Entry
4700              CDS       T01001                                 
Symbol
NDUFA6, B14, CI-B14, LYRM6, MC1DN33, NADHB14
Name
(RefSeq) NADH:ubiquinone oxidoreductase subunit A6
  KO
K03950  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 6
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04714  Thermogenesis
hsa04723  Retrograde endocannabinoid signaling
hsa04932  Non-alcoholic fatty liver disease
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05208  Chemical carcinogenesis - reactive oxygen species
hsa05415  Diabetic cardiomyopathy
Module
hsa_M00146  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
Network
nt06418  Oxidative phosphorylation
nt06460  Alzheimer disease
nt06463  Parkinson disease
nt06464  Amyotrophic lateral sclerosis
  Element
N00995  Electron transfer in Complex I
N00997  Mutation-caused aberrant Abeta to electron transfer in Complex I
N01042  Mutation-caused aberrant SNCA to electron transfer in Complex I
N01043  Mutation-inactivated PINK1 to electron transfer in Complex I
N01044  MPP+ to electron transfer in Complex I
N01045  Rotenone to electron transfer in Complex I
N01136  Mutation-caused aberrant TDP43 to electron transfer in Complex I
Disease
H00473  Mitochondrial complex I deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    4700 (NDUFA6)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    4700 (NDUFA6)
  09159 Environmental adaptation
   04714 Thermogenesis
    4700 (NDUFA6)
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    4700 (NDUFA6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    4700 (NDUFA6)
   05012 Parkinson disease
    4700 (NDUFA6)
   05014 Amyotrophic lateral sclerosis
    4700 (NDUFA6)
   05016 Huntington disease
    4700 (NDUFA6)
   05020 Prion disease
    4700 (NDUFA6)
   05022 Pathways of neurodegeneration - multiple diseases
    4700 (NDUFA6)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    4700 (NDUFA6)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    4700 (NDUFA6)
SSDB
Motif
Pfam: Complex1_LYR Complex1_LYR_2
Other DBs
NCBI-GeneID: 4700
NCBI-ProteinID: NP_002481
OMIM: 602138
HGNC: 7690
Ensembl: ENSG00000184983
Pharos: P56556(Tclin)
UniProt: P56556 A0A2Y9D025
Structure
LinkDB
Position
22:complement(42085526..42090772)
AA seq 128 aa
MAGSGVRQATSTASTFVKPIFSRDMNEAKRRVRELYRAWYREVPNTVHQFQLDITVKMGR
DKVREMFMKNAHVTDPRVVDLLVIKGKIELEETIKVWKQRTHVMRFFHETEAPRPKDFLS
KFYVGHDP
NT seq 387 nt   +upstreamnt  +downstreamnt
atggcggggagcggcgtccgccaagctacttctaccgccagcaccttcgtgaagcccatt
ttcagtcgggacatgaacgaggccaagcggagggtgcgcgagctctaccgcgcctggtat
cgggaggtgccgaacactgtgcaccaattccagctggacatcactgtgaaaatgggacgg
gataaagtccgagaaatgtttatgaagaatgcccatgtcacagaccccagggtggttgat
cttctggtcattaagggaaagatcgaactggaagaaacaattaaagtatggaagcagcgg
acacatgttatgcggttcttccatgaaacagaagcgccaaggccaaaggatttcctatcc
aagttctatgttggccacgatccatga

KEGG   Homo sapiens (human): 4701
Entry
4701              CDS       T01001                                 
Symbol
NDUFA7, B14.5a, CI-B14.5a
Name
(RefSeq) NADH:ubiquinone oxidoreductase subunit A7
  KO
K03951  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 7
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04714  Thermogenesis
hsa04723  Retrograde endocannabinoid signaling
hsa04932  Non-alcoholic fatty liver disease
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05208  Chemical carcinogenesis - reactive oxygen species
hsa05415  Diabetic cardiomyopathy
Module
hsa_M00146  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
Network
nt06418  Oxidative phosphorylation
nt06460  Alzheimer disease
nt06463  Parkinson disease
nt06464  Amyotrophic lateral sclerosis
  Element
N00995  Electron transfer in Complex I
N00997  Mutation-caused aberrant Abeta to electron transfer in Complex I
N01042  Mutation-caused aberrant SNCA to electron transfer in Complex I
N01043  Mutation-inactivated PINK1 to electron transfer in Complex I
N01044  MPP+ to electron transfer in Complex I
N01045  Rotenone to electron transfer in Complex I
N01136  Mutation-caused aberrant TDP43 to electron transfer in Complex I
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    4701 (NDUFA7)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    4701 (NDUFA7)
  09159 Environmental adaptation
   04714 Thermogenesis
    4701 (NDUFA7)
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    4701 (NDUFA7)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    4701 (NDUFA7)
   05012 Parkinson disease
    4701 (NDUFA7)
   05014 Amyotrophic lateral sclerosis
    4701 (NDUFA7)
   05016 Huntington disease
    4701 (NDUFA7)
   05020 Prion disease
    4701 (NDUFA7)
   05022 Pathways of neurodegeneration - multiple diseases
    4701 (NDUFA7)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    4701 (NDUFA7)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    4701 (NDUFA7)
SSDB
Motif
Pfam: CI-B14_5a
Other DBs
NCBI-GeneID: 4701
NCBI-ProteinID: NP_004992
OMIM: 602139
HGNC: 7691
Ensembl: ENSG00000267855
Pharos: O95182(Tclin)
UniProt: O95182
Structure
LinkDB
Position
19:complement(8308595..8321375)
AA seq 113 aa
MASATRLIQRLRNWASGHDLQGKLQLRYQEISKRTQPPPKLPVGPSHKLSNNYYCTRDGR
RESVPPSIIMSSQKALVSGKPAESSAVAATEKKAVTPAPPIKRWELSSDQPYL
NT seq 342 nt   +upstreamnt  +downstreamnt
atggcgtccgccacccgtctcatccagcggctgcggaactgggcgtccgggcatgacctg
caggggaagctgcagctacgctaccaggagatctccaagcgaactcagcctcctcccaag
ctccctgtgggtcctagccacaagctctccaacaattactattgcactcgcgatggccgc
cgggaatctgtgcccccttccatcatcatgtcgtcgcagaaggcgctggtgtcaggcaag
ccagcagagagctctgctgtagctgccactgagaagaaggcggtgactccagctcctccc
ataaagaggtgggagctgtcctcggaccagccttacctgtga

DBGET integrated database retrieval system