KEGG   Homo sapiens (human): 100532731
Entry
100532731         CDS       T01001                                 
Symbol
COMMD3-BMI1, BMI1, PCGF4, RNF51
Name
(RefSeq) COMMD3-BMI1 readthrough
  KO
K11459  polycomb group RING finger protein 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa05202  Transcriptional misregulation in cancer
hsa05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100532731 (COMMD3-BMI1)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100532731 (COMMD3-BMI1)
   05206 MicroRNAs in cancer
    100532731 (COMMD3-BMI1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    100532731 (COMMD3-BMI1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Histone modification proteins
   Polycomb group proteins
    PRC1 (polycomb repressive complex 1)
     100532731 (COMMD3-BMI1)
SSDB
Motif
Pfam: RAWUL zf-C3HC4_2 zf-C3HC4 zf-RING_2 zf-C3HC4_3 zf-rbx1 zf-RING_5 zf-RING_UBOX Prok-RING_4 zf-C3HC4_4 zf-Nse zf-RING_10
Other DBs
NCBI-GeneID: 100532731
NCBI-ProteinID: NP_001190991
HGNC: 48326
Ensembl: ENSG00000269897
Vega: OTTHUMG00000184031
UniProt: P35226 R4GMX3
Structure
LinkDB
Position
10:22316388..22331484
AA seq 469 aa
MELSESVQKGFQMLADPRSFDSNAFTLLLRAAFQSLLDAQADEAVLDHPDLKHIDPVVLK
HCHAAAATYILEAGKHRADKSTLSTYLEDCKFDRERIELFCTEYQNNKNSLEILLGRTLI
PHPIQRLVLVAAWNNYRIFYQAEMHRTTRIKITELNPHLMCVLCGGYFIDATTIIECLHS
FCKTCIVRYLETSKYCPICDVQVHKTRPLLNIRSDKTLQDIVYKLVPGLFKNEMKRRRDF
YAAHPSADAANGSNEDRGEVADEDKRIITDDEIISLSIEFFDQNRLDRKVNKDKEKSKEE
VNDKRYLRCPAAMTVMHLRKFLRSKMDIPNTFQIDVMYEEEPLKDYYTLMDIAYIYTWRR
NGPLPLKYRVRPTCKRMKISHQRDGLTNAGELESDSGSDKANSPAGGIPSTSSCLPSPST
PVQSPHPQFPHISSTMNGTSNSPSGNHQSSFANRPRKSSVNGSSATSSG
NT seq 1410 nt   +upstreamnt  +downstreamnt
atggagctctcggagtctgtgcagaaaggcttccagatgctggcggatccccgctccttc
gactccaacgccttcacgcttctcctccgggcggcattccagagtctgctggacgcccag
gcggacgaggccgtgttagatcatccagacttgaaacatatcgacccagtggttttaaaa
cattgtcatgcagcagctgcaacttacatactagaggcaggaaagcaccgagctgacaag
tcaactctaagcacttatctagaagactgtaaatttgacagagagcgaatagaactgttt
tgcacggaatatcagaataataagaattccctagaaatcctactgggaagaacactgatt
ccccatcctatccagagattagttttagttgcagcatggaacaattacaggattttttat
caagcagaaatgcatcgaacaacgagaatcaagatcactgagctaaatccccacctgatg
tgtgtgctttgtggagggtacttcattgatgccacaaccataatagaatgtctacattcc
ttctgtaaaacgtgtattgttcgttacctggagaccagcaagtattgtcctatttgtgat
gtccaagttcacaagaccagaccactactgaatataaggtcagataaaactctccaagat
attgtatacaaattagttccagggcttttcaaaaatgaaatgaagagaagaagggatttt
tatgcagctcatccttctgctgatgctgccaatggctctaatgaagatagaggagaggtt
gcagatgaagataagagaattataactgatgatgagataataagcttatccattgaattc
tttgaccagaacagattggatcggaaagtaaacaaagacaaagagaaatctaaggaggag
gtgaatgataaaagatacttacgatgcccagcagcaatgactgtgatgcacttaagaaag
tttctcagaagtaaaatggacatacctaatactttccagattgatgtcatgtatgaggag
gaacctttaaaggattattatacactaatggatattgcctacatttatacctggagaagg
aatggtccacttccattgaaatacagagttcgacctacttgtaaaagaatgaagatcagt
caccagagagatggactgacaaatgctggagaactggaaagtgactctgggagtgacaag
gccaacagcccagcaggaggtattccctccacctcttcttgtttgcctagccccagtact
ccagtgcagtctcctcatccacagtttcctcacatttccagtactatgaatggaaccagc
aacagccccagcggtaaccaccaatcttcttttgccaatagacctcgaaaatcatcagta
aatgggtcatcagcaacttcttctggttga

KEGG   Homo sapiens (human): 10336
Entry
10336             CDS       T01001                                 
Symbol
PCGF3, DONG1, RNF3, RNF3A
Name
(RefSeq) polycomb group ring finger 3
  KO
K11488  polycomb group RING finger protein 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    10336 (PCGF3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    10336 (PCGF3)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Histone modification proteins
   Polycomb group proteins
    Other polycomb group proteins
     10336 (PCGF3)
SSDB
Motif
Pfam: RAWUL zf-C3HC4_2 zf-C3HC4 zf-RING_2 zf-C3HC4_3 zf-RING_5 zf-rbx1 zf-RING_UBOX zf-C3HC4_4 zf-Nse zf-RING_4 DUF3337 zf-RING_10 GAGA Prok-RING_4
Other DBs
NCBI-GeneID: 10336
NCBI-ProteinID: NP_001304765
OMIM: 617543
HGNC: 10066
Ensembl: ENSG00000185619
Vega: OTTHUMG00000119000
Pharos: Q3KNV8(Tdark)
UniProt: Q3KNV8 B3KWT8 B4DTN5 B3KQ06
LinkDB
Position
4:705832..770089
AA seq 242 aa
MLTRKIKLWDINAHITCRLCSGYLIDATTVTECLHTFCRSCLVKYLEENNTCPTCRIVIH
QSHPLQYIGHDRTMQDIVYKLVPGLQEAEMRKQREFYHKLGMEVPGDIKGETCSAKQHLD
SHRNGETKADDSSNKEAAEEKPEEDNDYHRSDEQVSICLECNSSKLRGLKRKWIRCSAQA
TVLHLKKFIAKKLNLSSFNELDILCNEEILGKDHTLKFVVVTRWRFKKAPLLLHYRPKMD
LL
NT seq 729 nt   +upstreamnt  +downstreamnt
atgttgaccaggaagatcaagctgtgggacatcaacgcccacatcacctgccgcctgtgc
agcgggtacctcatcgacgccaccacggtgaccgagtgtctgcacaccttctgcaggagc
tgcctggtgaagtacctggaggagaacaacacctgccccacctgcaggattgtgatccac
cagagccaccccctgcagtacatcggtcatgacagaaccatgcaagatattgtttacaaa
ttggtaccaggcctccaagaagcggaaatgagaaagcagagggagttctatcacaaattg
ggcatggaggtgccgggagacatcaagggggagacctgctctgcaaaacagcacttagat
tcccatcggaatggtgaaaccaaagcagacgacagttcaaacaaagaggccgcggaggag
aagccggaggaggacaacgactaccaccgcagcgacgagcaggtgagcatctgcctggag
tgtaacagcagcaaactgcgcgggctgaagcggaagtggatccgctgctcagcccaggcg
accgtcttgcatctgaagaagttcatcgccaaaaaactcaacctttcatcctttaacgag
ctggacattttatgcaacgaggagatcctgggcaaggaccacacactcaagttcgtggtt
gtcactaggtggagattcaagaaggcgccgctcctgctgcactacagacccaagatggac
ttgctgtga

KEGG   Homo sapiens (human): 648
Entry
648               CDS       T01001                                 
Symbol
BMI1, FLVI2/BMI1, PCGF4, RNF51, flvi-2/bmi-1
Name
(RefSeq) BMI1 proto-oncogene, polycomb ring finger
  KO
K11459  polycomb group RING finger protein 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa05202  Transcriptional misregulation in cancer
hsa05206  MicroRNAs in cancer
Network
nt06240  Transcription
  Element
N00131  Amplified MYCN to transcriptional activation
Disease
H00025  Penile cancer
Drug target
Unesblin: D11889
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    648 (BMI1)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    648 (BMI1)
   05206 MicroRNAs in cancer
    648 (BMI1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    648 (BMI1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Histone modification proteins
   Polycomb group proteins
    PRC1 (polycomb repressive complex 1)
     648 (BMI1)
SSDB
Motif
Pfam: RAWUL zf-C3HC4_2 zf-C3HC4 zf-RING_2 zf-C3HC4_3 zf-RING_5 zf-rbx1 zf-RING_UBOX Prok-RING_4 zf-C3HC4_4 zf-RING_10 zf-Nse
Other DBs
NCBI-GeneID: 648
NCBI-ProteinID: NP_005171
OMIM: 164831
HGNC: 1066
Ensembl: ENSG00000168283
Vega: OTTHUMG00000017807
Pharos: P35226(Tbio)
UniProt: P35226
Structure
LinkDB
Position
10:22321099..22331484
AA seq 326 aa
MHRTTRIKITELNPHLMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQV
HKTRPLLNIRSDKTLQDIVYKLVPGLFKNEMKRRRDFYAAHPSADAANGSNEDRGEVADE
DKRIITDDEIISLSIEFFDQNRLDRKVNKDKEKSKEEVNDKRYLRCPAAMTVMHLRKFLR
SKMDIPNTFQIDVMYEEEPLKDYYTLMDIAYIYTWRRNGPLPLKYRVRPTCKRMKISHQR
DGLTNAGELESDSGSDKANSPAGGIPSTSSCLPSPSTPVQSPHPQFPHISSTMNGTSNSP
SGNHQSSFANRPRKSSVNGSSATSSG
NT seq 981 nt   +upstreamnt  +downstreamnt
atgcatcgaacaacgagaatcaagatcactgagctaaatccccacctgatgtgtgtgctt
tgtggagggtacttcattgatgccacaaccataatagaatgtctacattccttctgtaaa
acgtgtattgttcgttacctggagaccagcaagtattgtcctatttgtgatgtccaagtt
cacaagaccagaccactactgaatataaggtcagataaaactctccaagatattgtatac
aaattagttccagggcttttcaaaaatgaaatgaagagaagaagggatttttatgcagct
catccttctgctgatgctgccaatggctctaatgaagatagaggagaggttgcagatgaa
gataagagaattataactgatgatgagataataagcttatccattgaattctttgaccag
aacagattggatcggaaagtaaacaaagacaaagagaaatctaaggaggaggtgaatgat
aaaagatacttacgatgcccagcagcaatgactgtgatgcacttaagaaagtttctcaga
agtaaaatggacatacctaatactttccagattgatgtcatgtatgaggaggaaccttta
aaggattattatacactaatggatattgcctacatttatacctggagaaggaatggtcca
cttccattgaaatacagagttcgacctacttgtaaaagaatgaagatcagtcaccagaga
gatggactgacaaatgctggagaactggaaagtgactctgggagtgacaaggccaacagc
ccagcaggaggtattccctccacctcttcttgtttgcctagccccagtactccagtgcag
tctcctcatccacagtttcctcacatttccagtactatgaatggaaccagcaacagcccc
agcggtaaccaccaatcttcttttgccaatagacctcgaaaatcatcagtaaatgggtca
tcagcaacttcttctggttga

KEGG   Homo sapiens (human): 7703
Entry
7703              CDS       T01001                                 
Symbol
PCGF2, MEL-18, RNF110, TPFS, ZNF144
Name
(RefSeq) polycomb group ring finger 2
  KO
K11460  polycomb group RING finger protein 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    7703 (PCGF2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    7703 (PCGF2)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Histone modification proteins
   Polycomb group proteins
    PRC1 (polycomb repressive complex 1)
     7703 (PCGF2)
SSDB
Motif
Pfam: RAWUL zf-C3HC4_2 zf-C3HC4 zf-RING_2 zf-C3HC4_3 zf-rbx1 zf-RING_5 zf-RING_UBOX zf-Nse zf-C3HC4_4 zf-ANAPC11 zf-RING_10 Rad60-SLD Prok-RING_4
Other DBs
NCBI-GeneID: 7703
NCBI-ProteinID: NP_009075
OMIM: 600346
HGNC: 12929
Ensembl: ENSG00000277258
Vega: OTTHUMG00000188501
Pharos: P35227(Tbio)
UniProt: P35227 A0A024R1V6
LinkDB
Position
17:complement(38733898..38749792)
AA seq 344 aa
MHRTTRIKITELNPHLMCALCGGYFIDATTIVECLHSFCKTCIVRYLETNKYCPMCDVQV
HKTRPLLSIRSDKTLQDIVYKLVPGLFKDEMKRRRDFYAAYPLTEVPNGSNEDRGEVLEQ
EKGALSDDEIVSLSIEFYEGARDRDEKKGPLENGDGDKEKTGVRFLRCPAAMTVMHLAKF
LRNKMDVPSKYKVEVLYEDEPLKEYYTLMDIAYIYPWRRNGPLPLKYRVQPACKRLTLAT
VPTPSEGTNTSGASECESVSDKAPSPATLPATSSSLPSPATPSHGSPSSHGPPATHPTSP
TPPSTASGATTAANGGSLNCLQTPSSTSRGRKMTVNGAPVPPLT
NT seq 1035 nt   +upstreamnt  +downstreamnt
atgcatcggactacacggatcaaaatcacagagctgaacccccacctcatgtgtgccctc
tgcggggggtacttcatcgacgccaccactatcgtggagtgcctgcattccttctgcaaa
acctgcatcgtgcgctacctggagaccaacaaatactgccccatgtgtgacgtgcaggtc
cataaaacccggccgctgctgagcatcaggtctgacaaaacacttcaagacattgtctac
aaattggtccctgggctttttaaagatgagatgaaacggcggcgggatttctatgcagcg
taccccctgacggaggtccccaacggctccaatgaggaccgcggcgaggtcttggagcag
gagaagggggctctgagtgatgatgagattgtcagcctctccatcgaattctacgaaggt
gccagggaccgggacgagaagaagggccccctggagaatggggatggggacaaagagaaa
acaggggtgcgcttcctgcgatgcccagcagccatgaccgtcatgcatcttgccaagttt
ctccgcaacaagatggatgtgcccagcaagtacaaggtggaggttctgtacgaggacgag
ccactgaaggaatactacaccctcatggacatcgcctacatctacccctggcggcggaac
gggcctctccccctcaagtaccgtgtccagccagcctgcaagcggctcaccctagccacg
gtgcccaccccctccgagggcaccaacaccagcggggcgtccgagtgtgagtcagtcagc
gacaaggctcccagccctgccaccctgccagccacctcctcctccctgcccagcccagcc
accccatcccatggctctcccagttcccatgggcctccagccacccaccctacctccccc
actcccccttcgacagccagtggggccaccacagctgccaacgggggtagcttgaactgc
ctgcagacaccatcctccaccagcagggggcgcaagatgactgtcaacggcgctcccgtg
ccccccttaacttga

KEGG   Homo sapiens (human): 84108
Entry
84108             CDS       T01001                                 
Symbol
PCGF6, MBLR, RNF134
Name
(RefSeq) polycomb group ring finger 6
  KO
K11470  polycomb group RING finger protein 6
Organism
hsa  Homo sapiens (human)
Pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    84108 (PCGF6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    84108 (PCGF6)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Histone modification proteins
   Polycomb group proteins
    Other polycomb group proteins
     84108 (PCGF6)
SSDB
Motif
Pfam: zf-C3HC4_2 zf-C3HC4 RAWUL zf-RING_2 zf-RING_UBOX zf-C3HC4_3 zf-RING_5 zf-RING_6 zf-RING_10 BUD22 zf-C3HC4_4 zf-rbx1
Other DBs
NCBI-GeneID: 84108
NCBI-ProteinID: NP_001011663
OMIM: 607816
HGNC: 21156
Ensembl: ENSG00000156374
Vega: OTTHUMG00000018982
Pharos: Q9BYE7(Tbio)
UniProt: Q9BYE7
Structure
LinkDB
Position
10:complement(103302796..103351140)
AA seq 350 aa
MEGVAVVTAGSVGAAKTEGAAALPPPPPVSPPALTPAPAAGEEGPAPLSETGAPGCSGSR
PPELEPERSLGRFRGRFEDEDEELEEEEELEEEEEEEEEDMSHFSLRLEGGRQDSEDEEE
RLINLSELTPYILCSICKGYLIDATTITECLHTFCKSCIVRHFYYSNRCPKCNIVVHQTQ
PLYNIRLDRQLQDIVYKLVINLEEREKKQMHDFYKERGLEVPKPAVPQPVPSSKGRSKKV
LESVFRIPPELDMSLLLEFIGANEGTGHFKPLEKKFVRVSGEATIGHVEKFLRRKMGLDP
ACQVDIICGDHLLEQYQTLREIRRAIGDAAMQDGLLVLHYGLVVSPLKIT
NT seq 1053 nt   +upstreamnt  +downstreamnt
atggagggggtcgcggtggtgacggcgggcagcgtaggcgctgccaaaaccgagggagct
gcagccttgccgcctccgcctcctgtctccccgcccgccctcacccctgcacccgcagcg
ggtgaggagggaccggcgcctctgtctgagacgggggctcccggctgctccggctcccgg
ccccctgagctggagccggagcgcagcctgggccgcttcagaggccgcttcgaggacgag
gacgaggagttggaagaagaagaggagctggaggaggaagaagaggaggaggaggaggac
atgagtcacttctcgttgaggctggagggaggccggcaggactcggaggacgaggaggag
cgcctgattaatctctctgagctgaccccatacatcttgtgttccatttgcaaaggttac
ttaatagatgcaactaccatcacagaatgtcttcataccttttgtaaaagctgcatcgta
agacatttttactacagcaacagatgtccaaaatgcaatatagtagtacatcagacacaa
cctctttataacataaggttggaccgacagttacaagacatagtgtacaaattagtgatc
aatctagaggaaagagaaaaaaagcaaatgcatgatttctataaagaaagaggtctagaa
gtacctaaacctgctgttccacagccagtcccttcaagcaaaggaagatctaaaaaagtc
ctagaatcagtgtttcgtattccacctgaacttgatatgtctttattactggagttcatt
ggtgctaatgaaggcacgggacattttaagccattggaaaagaagtttgttcgagtttca
ggagaagcaactattggacatgtagaaaaattcctcagaagaaaaatgggtcttgatcca
gcttgtcaggtagatataatctgtggtgatcacctgttggagcagtatcaaactctaagg
gaaatccgacgtgcaataggtgatgcagcaatgcaggatggtctgcttgtccttcattat
ggtcttgtggtttctcctctgaagataacttga

KEGG   Homo sapiens (human): 84333
Entry
84333             CDS       T01001                                 
Symbol
PCGF5, RNF159
Name
(RefSeq) polycomb group ring finger 5
  KO
K11489  polycomb group RING finger protein 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    84333 (PCGF5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    84333 (PCGF5)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Histone modification proteins
   Polycomb group proteins
    AUTS2-polycomb complex
     84333 (PCGF5)
SSDB
Motif
Pfam: RAWUL zf-C3HC4_2 zf-C3HC4 zf-RING_UBOX zf-RING_2 zf-C3HC4_4 zf-C3HC4_3 zf-RING_5 zf-RING_10 zf-Nse zf-RING_6 zf-rbx1
Other DBs
NCBI-GeneID: 84333
NCBI-ProteinID: NP_001243478
OMIM: 617407
HGNC: 28264
Ensembl: ENSG00000180628
Vega: OTTHUMG00000018740
Pharos: Q86SE9(Tdark)
UniProt: Q86SE9
Structure
LinkDB
Position
10:91156219..91284337
AA seq 256 aa
MATQRKHLVKDFNPYITCYICKGYLIKPTTVTECLHTFCKTCIVQHFEDSNDCPRCGNQV
HETNPLEMLRLDNTLEEIIFKLVPGLREQELERESEFWKKNKPQENGQDDTSKADKPKVD
EEGDENEDDKDYHRSDPQIAICLDCLRNNGQSGDNVVKGLMKKFIRCSTRVTVGTIKKFL
SLKLKLPSSYELDVLCNGEIMGKDHTMEFIYMTRWRLRGENFRCLNCSASQVCSQDGPLY
QSYPMVLQYRPRIDFG
NT seq 771 nt   +upstreamnt  +downstreamnt
atggctacccaaaggaaacacttggtgaaagattttaatccttacattacctgctatatc
tgtaaagggtatctgatcaagccaacaacagtgacggaatgcctccatacattctgtaag
acttgtattgttcagcactttgaagatagcaatgattgcccaaggtgtggcaaccaagtt
catgagacaaatccattagaaatgttgaggttggacaatacattagaggaaattatattt
aagctggtccctggactacgagaacaagaacttgagcgtgaatctgaattttggaagaaa
aataagcctcaagaaaatggacaagatgatacttcaaaagctgacaaaccgaaagtagat
gaagaaggtgatgaaaatgaagatgataaagattatcacagaagtgacccacaaattgct
atctgtctagattgtttacgaaataatgggcaatcaggggacaatgtagtaaagggttta
atgaagaaattcattcgatgttctacacgtgtaactgtgggaactattaaaaaatttcta
agtttaaaactaaaacttccaagttcttatgagttggatgtgctgtgcaatggtgaaatt
atggggaaggatcatactatggaattcatctacatgacaagatggcgactaagaggcgaa
aactttcggtgtctgaactgctcagcttcgcaagtctgctctcaggatggccctttgtat
cagtcataccctatggtactgcagtatcgaccaagaattgatttcggttag

KEGG   Homo sapiens (human): 84759
Entry
84759             CDS       T01001                                 
Symbol
PCGF1, 2010002K04Rik, NSPC1, RNF3A-2, RNF68
Name
(RefSeq) polycomb group ring finger 1
  KO
K11487  polycomb group RING finger protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    84759 (PCGF1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    84759 (PCGF1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Histone modification proteins
   Polycomb group proteins
    Other polycomb group proteins
     84759 (PCGF1)
SSDB
Motif
Pfam: RAWUL zf-C3HC4_2 zf-C3HC4 zf-RING_2 zf-C3HC4_3 zf-rbx1 zf-RING_5 Rad60-SLD zf-RING_UBOX ATG8 zf-Nse Cobl zf-ANAPC11 zf-C3HC4_4 zf-RING_10
Other DBs
NCBI-GeneID: 84759
NCBI-ProteinID: NP_116062
OMIM: 610231
HGNC: 17615
Ensembl: ENSG00000115289
Vega: OTTHUMG00000129954
Pharos: Q9BSM1(Tbio)
UniProt: Q9BSM1
Structure
LinkDB
Position
2:complement(74505043..74507695)
AA seq 259 aa
MASPQGGQIAIAMRLRNQLQSVYKMDPLRNEEEVRVKIKDLNEHIVCCLCAGYFVDATTI
TECLHTFCKSCIVKYLQTSKYCPMCNIKIHETQPLLNLKLDRVMQDIVYKLVPGLQDSEE
KRIREFYQSRGLDRVTQPTGEEPALSNLGLPFSSFDHSKAHYYRYDEQLNLCLERLSSGK
DKNKSVLQNKYVRCSVRAEVRHLRRVLCHRLMLNPQHVQLLFDNEVLPDHMTMKQIWLSR
WFGKPSPLLLQYSVKEKRR
NT seq 780 nt   +upstreamnt  +downstreamnt
atggcgtctcctcaggggggccagattgcgatcgcgatgaggcttcggaaccagctccag
tcagtgtacaagatggacccgctacggaacgaggaggaggttcgagtgaagatcaaagac
ttgaatgaacacattgtttgctgcctatgcgccggctacttcgtggatgccaccaccatc
acagagtgtcttcatactttctgcaagagttgtattgtgaagtacctccaaactagcaag
tactgccccatgtgcaacattaagatccacgagacacagccactgctcaacctcaaactg
gaccgggtcatgcaggacatcgtgtataagctggtgcctggcttgcaagacagtgaagag
aaacggattcgggaattctaccagtcccgaggtttggaccgggtcacccagcccactggg
gaagagccagcactgagcaacctcggcctccccttcagcagctttgaccactctaaagcc
cactactatcgctatgatgagcagttgaacctgtgcctggagcggctgagttctggcaaa
gacaagaataaaagcgtcctgcagaacaagtatgtccgatgttctgttagagctgaggta
cgccatctccggagggtcctgtgtcaccgcttgatgctaaaccctcagcatgtgcagctc
ctttttgacaatgaagttctccctgatcacatgacaatgaagcagatatggctctcccgc
tggttcggcaagccatcccctttgcttttacaatacagtgtgaaagagaagaggaggtag

DBGET integrated database retrieval system