KEGG   Homo sapiens (human): 100653049
Entry
100653049         CDS       T01001                                 
Name
(RefSeq) keratin, type I cuticular Ha4
  KO
K07604  type I keratin, acidic
Organism
hsa  Homo sapiens (human)
Pathway
hsa04915  Estrogen signaling pathway
hsa05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    100653049
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    100653049
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    100653049
   04147 Exosome [BR:hsa04147]
    100653049
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     100653049
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   100653049
  Exosomal proteins of other body fluids (saliva and urine)
   100653049
  Exosomal proteins of colorectal cancer cells
   100653049
  Exosomal proteins of melanoma cells
   100653049
SSDB
Motif
Pfam: Filament Baculo_PEP_C
Other DBs
NCBI-GeneID: 100653049
NCBI-ProteinID: XP_003403930
UniProt: O76011 A0A140TA62
LinkDB
Position
17
AA seq 436 aa
MLYAKPPPTINGIKGLQRKERLKPAHIHLQQLTCFSITCSSTMSYSCCLPSLGCRTSCSS
RPCVPPSCHGYTLPGACNIPANVSNCNWFCEGSFNGSEKETMQFLNDRLASYLEKVRQLE
RDNAELEKLIQERSQQQEPLLCPSYQSYFKTIEELQQKILCAKAENARLVVNIDNAKLAS
DDFRSKYQTEQSLRLLVESDINSIRRILDELTLCKSDLESQVESLREELICLKKNHEEEV
NTLRSQLGDRLNVEVDTAPTVDLNQVLNETRSQYEALVETNRREVEQWFATQTEELNKQV
VSSSEQLQSCQAEIIELRRTVNALEIELQAQHNLRDSLENTLTESEAHYSSQLSQVQSLI
TNVESQLAEIRCDLERQNQEYQVLLDVRARLECEINTYRSLLESEDCKLPCNPCATTNAS
GNSCGPCGTSQKGCCN
NT seq 1311 nt   +upstreamnt  +downstreamnt
atgctgtatgccaagcccccacccacaattaatggtataaaaggactgcagaggaaggag
agactcaaacctgcccacatccacctccagcagcttacctgcttttccattacctgttcc
agcaccatgtcttacagttgttgcctgcccagcctgggctgccgcaccagctgctcctcc
cggccctgcgtgccccccagctgccacggctacaccctgcctggggcctgcaacatcccc
gccaatgtgagcaactgcaactggttctgtgagggctccttcaatggcagcgagaaggag
actatgcagttcctgaacgaccgcctggccagctacctggagaaggtgcgtcagctggag
cgggacaacgcggagctggagaaactcatccaggagcggtcccagcagcaggagcccttg
ctgtgccccagctaccagtcgtacttcaagaccattgaggagctccagcagaagattctg
tgtgccaaggctgagaatgccaggctggtggtgaacattgacaatgccaagctggcctct
gacgacttcagaagcaagtaccagacggagcagtccctgaggctgttggtggagtcggac
atcaacagcatacgcaggatcctggatgagctgaccctctgcaagtctgacctggagtcc
caggtggagtccctgagggaggagctgatctgcttgaagaagaaccatgaggaggaggtt
aacaccctgcgctcccagcttggagaccgcctcaacgtggaggtggacactgcccccact
gtggacctgaaccaggtcctgaacgagaccaggagtcagtatgaggctctggtggaaact
aaccgcagggaagtggagcaatggttcgccacgcagaccgaggagctgaacaagcaggtg
gtatccagctcagagcagctgcagtcctgccaggcggagatcatcgagctgagacgcaca
gtcaacgccctggagatcgagctgcaggcccagcacaacctgcgagactctctggaaaac
acgctgacggagagcgaggcccactacagctcccagctgtcccaggtgcagagcctgatc
accaacgtggagtctcagctggcagagatccgctgtgacctggagcggcagaaccaggag
taccaggtgctgctggacgtgcgtgcccggctggagtgtgagatcaacacgtaccggagc
ctcctggagagtgaggactgcaagctcccctgcaacccatgcgccaccaccaatgctagt
ggcaactcctgtggaccctgtggcacctctcaaaagggttgctgtaattga

KEGG   Homo sapiens (human): 125115
Entry
125115            CDS       T01001                                 
Symbol
KRT40, CK-40, K40, KA36
Name
(RefSeq) keratin 40
  KO
K07604  type I keratin, acidic
Organism
hsa  Homo sapiens (human)
Pathway
hsa04915  Estrogen signaling pathway
hsa05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    125115 (KRT40)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    125115 (KRT40)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    125115 (KRT40)
   04147 Exosome [BR:hsa04147]
    125115 (KRT40)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     125115 (KRT40)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   125115 (KRT40)
  Exosomal proteins of other body fluids (saliva and urine)
   125115 (KRT40)
  Exosomal proteins of colorectal cancer cells
   125115 (KRT40)
  Exosomal proteins of melanoma cells
   125115 (KRT40)
SSDB
Motif
Pfam: Filament ERM_helical TcpS ArdA
Other DBs
NCBI-GeneID: 125115
NCBI-ProteinID: NP_872303
OMIM: 616679
HGNC: 26707
Ensembl: ENSG00000204889
Pharos: Q6A162(Tdark)
UniProt: Q6A162
LinkDB
Position
17:complement(40977715..40987135)
AA seq 431 aa
MTSDCSSTHCSPESCGTASGCAPASSCSVETACLPGTCATSRCQTPSFLSRSRGLTGCLL
PCYFTGSCNSPCLVGNCAWCEDGVFTSNEKETMQFLNDRLASYLEKVRSLEETNAELESR
IQEQCEQDIPMVCPDYQRYFNTIEDLQQKILCTKAENSRLAVQLDNCKLATDDFKSKYES
ELSLRQLLEADISSLHGILEELTLCKSDLEAHVESLKEDLLCLKKNHEEEVNLLREQLGD
RLSVELDTAPTLDLNRVLDEMRCQCETVLANNRREAEEWLAVQTEELNQQQLSSAEQLQG
CQMEILELKRTASALEIELQAQQSLTESLECTVAETEAQYSSQLAQIQCLIDNLENQLAE
IRCDLERQNQEYQVLLDVKARLEGEINTYWGLLDSEDSRLSCSPCSTTCTSSNTCEPCSA
YVICTVENCCL
NT seq 1296 nt   +upstreamnt  +downstreamnt
atgacttctgactgctcctccacacactgctctcctgagtcctgtggcacggcttccggt
tgtgcacctgcctcaagctgctccgtggaaacagcttgtctccccggtacctgtgctaca
tcccgatgtcagactccaagcttcctatccaggtctcgcgggctgactggttgcctcctg
ccatgctactttactgggagttgtaatagtccctgcttggtggggaactgtgcctggtgt
gaggatggggtgttcactagcaatgagaaggagacgatgcagttcctgaatgacagactc
gccagctatctggagaaggtgcgcagcctggaggagaccaacgcagagctggaatccagg
atccaagaacaatgtgaacaggatatcccaatggtgtgcccggattatcagcgttacttc
aacaccattgaagatctccaacaaaagatcttatgcacgaaagcagagaattctagactt
gctgtacagcttgacaactgcaaactggccactgatgactttaagtcaaagtacgagagt
gaactgtcccttcgccagctgttagaggctgacatcagcagcctgcatgggatcctggag
gaactgaccctgtgcaaatctgatctggaggcccatgtggagtctctgaaggaagatctc
ctttgccttaagaaaaaccatgaagaggaagtcaacttgcttcgtgaacagcttggcgac
cgcctcagtgtggagctggacactgcccccacccttgacctcaacagggtcctggatgag
atgcgctgtcagtgtgaaacggtgcttgccaacaatcgcagagaagctgaagaatggttg
gctgttcagacagaagagctgaatcagcagcaactgtccagcgcggagcagctgcagggc
tgccagatggagatcttggaactgaaacgcacagccagtgctctggaaattgagctccaa
gcacagcaaagcctgacagaatctctggaatgcaccgtggcagaaaccgaggcccagtac
agctcccagctggcccaaattcagtgtctgatcgataacctggagaaccagctggccgag
atccgctgcgacctggagcgacagaaccaggagtaccaggtgctcctggacgtgaaggcc
cggctggagggtgagatcaacacgtactggggcctgctggacagcgaggacagcaggctt
tcctgtagcccatgttcgaccacatgcacctcgagcaacacttgtgagccatgctcagcc
tatgtcatctgcactgttgaaaactgctgcttgtga

KEGG   Homo sapiens (human): 147183
Entry
147183            CDS       T01001                                 
Symbol
KRT25, ARWH3, KRT24IRS1, KRT25A
Name
(RefSeq) keratin 25
  KO
K07604  type I keratin, acidic
Organism
hsa  Homo sapiens (human)
Pathway
hsa04915  Estrogen signaling pathway
hsa05150  Staphylococcus aureus infection
Disease
H00667  Woolly hair
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    147183 (KRT25)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    147183 (KRT25)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    147183 (KRT25)
   04147 Exosome [BR:hsa04147]
    147183 (KRT25)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     147183 (KRT25)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   147183 (KRT25)
  Exosomal proteins of other body fluids (saliva and urine)
   147183 (KRT25)
  Exosomal proteins of colorectal cancer cells
   147183 (KRT25)
  Exosomal proteins of melanoma cells
   147183 (KRT25)
SSDB
Motif
Pfam: Filament Phage_Mu_Gam TPR_MLP1_2
Other DBs
NCBI-GeneID: 147183
NCBI-ProteinID: NP_853512
OMIM: 616646
HGNC: 30839
Ensembl: ENSG00000204897
Pharos: Q7Z3Z0(Tbio)
UniProt: Q7Z3Z0 Q6ZPD6
LinkDB
Position
17:complement(40748021..40755542)
AA seq 450 aa
MSLRLSSASRRSCPRPTTGSLRLYGGGTSFGTGNSCGISGIGSGFSSAFGGSSSGGNTGG
GNPCAGFTVNERGLLSGNEKVTMQNLNDRLASYLDSVHALEEANADLEQKIKGWYEKFGP
GSCRGLDHDYSRYFPIIDDLKNQIIASTTSNANAVLQIDNARLTADDFRLKYENELALHQ
SVEADVNGLRRVLDEITLCRTDLEIQYETLSEEMTYLKKNHKEEMQVLQCAAGGNVNVEM
NAAPGVDLTVLLNNMRAEYEALAEQNRRDAEAWFNEKSASLQQQISEDVGATTSARNELT
EMKRTLQTLEIELQSLLATKHSLECSLTETESNYCAQLAQIQAQIGALEEQLHQVRTETE
GQKLEYEQLLDIKLHLEKEIETYCLLIGGDDGACKSGGYKSKDYGSGNVGSQVKDPAKAI
VVKKVLEEVDQRSKILTTRLHSLEEKSQSN
NT seq 1353 nt   +upstreamnt  +downstreamnt
atgtctcttcgactttccagtgcatccaggaggtcctgtcctcgtcccaccactggatca
ctcagactctatggtgggggaaccagctttggtactggaaattcttgtggcatttcaggg
attggaagtggcttctctagtgccttcggaggcagctcatcgggaggaaacacaggggga
ggtaatccctgtgctggcttcactgtgaatgagcgggggctcctttctggcaatgagaag
gtgaccatgcagaacctcaatgaccgcctggcatcctacctggacagtgtgcatgctctg
gaggaggccaacgctgacctggagcagaagatcaagggctggtatgagaaatttgggcct
ggctcttgccgtggtcttgatcatgactatagcagatatttcccaataattgatgacctt
aaaaatcagatcatcgcatccaccaccagcaatgctaatgctgttctgcagatcgataat
gccaggcttacagctgatgatttcagactcaagtatgaaaatgagctggctcttcaccag
agtgtagaggctgatgtcaatgggttacgaagagttttggatgaaataaccctgtgcaga
acagatctggagattcagtatgaaaccctgagtgaggagatgacttacctcaaaaagaac
cataaagaggaaatgcaagttctgcagtgcgcagctggaggcaacgtgaacgtggagatg
aacgcagcccccggggtggacctcacagttctgctgaacaacatgcgagctgagtacgaa
gcccttgcagagcagaaccgcagggacgcggaggcctggttcaacgagaagagcgcctcc
ctgcagcagcagatctctgaggatgtcggagccacaacctcagcccggaatgagctgact
gaaatgaagcgcactcttcaaaccctggaaattgaacttcagtctctcctagccacgaaa
cactccctggagtgctccttgacagagaccgagagcaactactgtgcgcagctggcgcag
atccaggctcagatcggggccctggaggagcagctgcaccaggtcagaaccgagaccgag
ggccagaagctggagtatgagcagctcctggacatcaagctccacctggaaaaagaaatt
gagacctactgtctccttataggaggagatgatggagcctgtaagtctgggggttacaag
tctaaagattatggatctggaaatgtgggaagtcaagtcaaagacccagccaaagccata
gtggttaagaaagttcttgaggaggtagaccaacgcagcaaaatacttaccaccaggctc
cactccctggaagagaaatctcaaagcaattaa

KEGG   Homo sapiens (human): 162605
Entry
162605            CDS       T01001                                 
Symbol
KRT28, K25IRS4, KRT25D
Name
(RefSeq) keratin 28
  KO
K07604  type I keratin, acidic
Organism
hsa  Homo sapiens (human)
Pathway
hsa04915  Estrogen signaling pathway
hsa05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    162605 (KRT28)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    162605 (KRT28)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    162605 (KRT28)
   04147 Exosome [BR:hsa04147]
    162605 (KRT28)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     162605 (KRT28)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   162605 (KRT28)
  Exosomal proteins of other body fluids (saliva and urine)
   162605 (KRT28)
  Exosomal proteins of colorectal cancer cells
   162605 (KRT28)
  Exosomal proteins of melanoma cells
   162605 (KRT28)
SSDB
Motif
Pfam: Filament Phage_Mu_Gam TPR_MLP1_2 FlxA
Other DBs
NCBI-GeneID: 162605
NCBI-ProteinID: NP_853513
OMIM: 616677
HGNC: 30842
Ensembl: ENSG00000173908
Pharos: Q7Z3Y7(Tdark)
UniProt: Q7Z3Y7
LinkDB
Position
17:complement(40792196..40799959)
AA seq 464 aa
MSLQFSNGSRHVCLRSGAGSVRPLNGGAGFAGSSACGGSVAGSEFSCALGGGLGSVPGGS
HAGGALGNAACIGFAGSEGGLLSGNEKVTMQNLNDRLASYLDNVRALEEANAELERKIKG
WYEKYGPGSCRGLDHDYSRYHLTIEDLKNKIISSTTTNANVILQIDNARLAADDFRLKYE
NELTLHQNVEADINGLRRVLDELTLCRTDQELQYESLSEEMTYLKKNHEEEMKALQCAAG
GNVNVEMNAAPGVDLAVLLNNMRAEYEALAEQNRKDAEAWFNEKSASLQQQISHDSGAAT
FARSQLTEMRRTLQTLEIQLQSLMATKHSLECSLTETESNYCTQLAQIQAQIGALEEQLH
QVRTETEGQKLEYEHLLDVKVHLEKEIETYCRLIDGDGNSCSKSKGFGSGSPGNSSKDLS
KTTLVKTVVEELDQRGKVLSSRIHSIEEKTSKMTNGKTEQRVPF
NT seq 1395 nt   +upstreamnt  +downstreamnt
atgtctctccaattttctaatggatccaggcatgtttgcttaaggtctggagctggatct
gtcagacccctcaatggaggtgcaggctttgcaggcagcagtgcatgtggtggctctgtt
gctggaagtgaattttcctgtgccttgggagggggcttgggcagtgttcctggtgggagc
catgctggtggtgcccttggaaatgctgcttgtattggctttgctggaagcgaaggggga
ctcctctctggaaatgagaaggtgaccatgcaaaatcttaatgaccgcttggcatcctac
ctggataatgtgcgagctctggaggaggcaaatgctgaattagagagaaaaatcaagggt
tggtatgaaaaatacggacctggatcttgccgtggacttgatcatgactatagcagatat
cacctaacaattgaggatcttaagaataagattatctcctccactactactaatgctaat
gtcattctgcagattgataatgccagactggctgctgatgatttcaggctaaagtatgaa
aatgagctcacccttcaccaaaacgtagaggccgacatcaacggattacggcgagtcctg
gacgagctgacgctctgcaggaccgaccaggagctgcaatatgagtctctgagtgaggag
atgacatatctcaaaaagaaccacgaagaggagatgaaggctctgcagtgcgcggctggg
ggcaacgtgaacgtggagatgaacgcggccccgggggtagacctcgcggttttgttgaac
aacatgcgagcggagtacgaagcccttgcagagcagaaccgcaaggacgcggaggcctgg
ttcaatgagaagagcgcctcgctgcagcaacagatctcccacgactcaggcgcagccact
ttcgcccggagccagctcaccgagatgaggcgcaccctgcagaccctggagatccagctg
cagtccctgatggccacgaaacactccctggagtgctccttgacagagaccgagagcaac
tactgtacgcagctggcgcagatccaggctcagatcggggccctggaggagcagctgcac
caggtcagaaccgagaccgagggccagaagctggagtatgagcatctcctcgatgtcaag
gtccacttggaaaaagaaattgagacctactgccgcctgatagatggagatggaaattca
tgctccaaatcaaagggctttggatcaggaagccctgggaattcatctaaagatttatcc
aaaaccacactggtaaagacagtggttgaagagctagatcaacgtggtaaagttctttca
tcaaggattcactccattgaagaaaagacatctaaaatgaccaacggcaagacagaacaa
agggttcctttctag

KEGG   Homo sapiens (human): 192666
Entry
192666            CDS       T01001                                 
Symbol
KRT24, K24, KA24
Name
(RefSeq) keratin 24
  KO
K07604  type I keratin, acidic
Organism
hsa  Homo sapiens (human)
Pathway
hsa04915  Estrogen signaling pathway
hsa05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    192666 (KRT24)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    192666 (KRT24)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    192666 (KRT24)
   04147 Exosome [BR:hsa04147]
    192666 (KRT24)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     192666 (KRT24)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   192666 (KRT24)
  Exosomal proteins of other body fluids (saliva and urine)
   192666 (KRT24)
  Exosomal proteins of colorectal cancer cells
   192666 (KRT24)
  Exosomal proteins of melanoma cells
   192666 (KRT24)
SSDB
Motif
Pfam: Filament DUF4407 TPR_MLP1_2 FlxA Taxilin DUF4515 GAS APG6_N Nuf2_DHR10-like Prominin Lzipper-MIP1
Other DBs
NCBI-GeneID: 192666
NCBI-ProteinID: NP_061889
OMIM: 607742
HGNC: 18527
Ensembl: ENSG00000167916
Pharos: Q2M2I5(Tbio)
UniProt: Q2M2I5
LinkDB
Position
17:complement(40694246..40703752)
AA seq 525 aa
MSCSSRASSSRAGGSSSARVSAGGSSFSSGSRCGLGGSSAQGFRGGASSCSLSGGSSGAF
GGSFGGGFGSCSVGGGFGGASGSGTGFGGGSSFGGVSGFGRGSGFCGSSRFSSGATGGFY
SYGGGMGGGVGDGGLFSGGEKQTMQNLNDRLANYLDKVRALEEANTDLENKIKEWYDKYG
PGSGDGGSGRDYSKYYSIIEDLRNQIIAATVENAGIILHIDNARLAADDFRLKYENELCL
RQSVEADINGLRKVLDDLTMTRSDLEMQIESFTEELAYLRKNHEEEMKNMQGSSGGEVTV
EMNAAPGTDLTKLLNDMRAQYEELAEQNRREAEERFNKQSASLQAQISTDAGAATSAKNE
ITELKRTLQALEIELQSQLAMKSSLEGTLADTEAGYVAQLSEIQTQISALEEEICQIWGE
TKCQNAEYKQLLDIKTRLEVEIETYRRLLDGEGGGSSFAEFGGRNSGSVNMGSRDLVSGD
SRSGSCSGQGRDSSKTRVTKTIVEELVDGKVVSSQVSSISEVKVK
NT seq 1578 nt   +upstreamnt  +downstreamnt
atgtcttgctcgtctcgcgcctcctcctccagggctggaggcagcagctcagccagggtg
tctgctggtggaagcagcttcagcagtggaagcagatgtggtctggggggcagctcggcc
cagggcttccgaggaggagccagcagctgcagcctgagtggggggtctagcggtgctttt
gggggcagctttggagggggctttggtagctgctcagtagggggtggttttgggggagct
tcaggctctgggacaggatttggtgggggttctagctttggcggggtctctggatttggc
aggggttctggattctgtgggagttctagattcagcagtggtgctactggaggcttctac
agctatggtggtggtatgggaggtggtgttggcgatggggggcttttctctggaggggaa
aagcaaaccatgcagaacctcaatgaccgcttggccaattacctagacaaggtcagagcc
ctggaggaggctaacactgatctggagaacaaaatcaaggagtggtatgacaaatatggg
cctgggtctggagacggtggatcgggaagagattatagcaaatactattcaataattgaa
gatctcagaaaccagatcattgctgccactgttgaaaatgctgggatcattttgcacatt
gacaatgccagattggctgctgatgacttcagactgaagtatgagaacgagctgtgtctc
cggcagagcgtggaggctgacatcaatggcctgcggaaagtcctggatgacctgactatg
acccgctctgacctggagatgcagattgagagtttcaccgaggagctagcctacctgagg
aagaaccacgaggaggaaatgaagaatatgcaaggaagctctggaggggaggtgaccgta
gaaatgaatgctgcgccagggaccgacctgaccaaattactgaatgacatgagggcgcag
tacgaggagctggctgagcaaaaccgccgagaggctgaggagcggttcaacaagcagagc
gcatcactacaagcacaaatctccactgatgctggggcagccacttctgccaagaatgag
ataacagaactaaaacgtaccctgcaagccctggaaattgagcttcagtcccaactggcc
atgaaaagctccctggagggaaccctggctgacacagaagctggctacgtggctcagctg
tcagaaattcaaacgcagatcagtgccctggaggaggagatctgccagatctggggtgag
actaaatgccagaacgcagagtacaagcaattgctggacatcaagacacgcctggaggtg
gagatcgagacctaccgccgcctgctcgatggagagggaggtggttctagttttgcagaa
tttggtggtagaaactcaggatctgtaaacatgggatccagggatctggtatctggtgac
tcaagatctggaagctgttctggtcaaggacgagattcaagcaagactagagtgactaag
actatcgtagaggagttggtggatggcaaggttgtctcgtctcaagtcagcagtatttct
gaggtgaaagttaaataa

KEGG   Homo sapiens (human): 25984
Entry
25984             CDS       T01001                                 
Symbol
KRT23, CK23, HAIK1, K23
Name
(RefSeq) keratin 23
  KO
K07604  type I keratin, acidic
Organism
hsa  Homo sapiens (human)
Pathway
hsa04915  Estrogen signaling pathway
hsa05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    25984 (KRT23)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    25984 (KRT23)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    25984 (KRT23)
   04147 Exosome [BR:hsa04147]
    25984 (KRT23)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     25984 (KRT23)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   25984 (KRT23)
  Exosomal proteins of other body fluids (saliva and urine)
   25984 (KRT23)
  Exosomal proteins of colorectal cancer cells
   25984 (KRT23)
  Exosomal proteins of melanoma cells
   25984 (KRT23)
SSDB
Motif
Pfam: Filament CENP-F_leu_zip DUF1664 NAPRTase_C Fez1 Jnk-SapK_ap_N HR1
Other DBs
NCBI-GeneID: 25984
NCBI-ProteinID: NP_056330
OMIM: 606194
HGNC: 6438
Ensembl: ENSG00000108244
Pharos: Q9C075(Tbio)
UniProt: Q9C075 A0A024R1X9 Q8TC04
LinkDB
Position
17:complement(40922700..40937646)
AA seq 422 aa
MNSGHSFSQTPSASFHGAGGGWGRPRSFPRAPTVHGGAGGARISLSFTTRSCPPPGGSWG
SGRSSPLLGGNGKATMQNLNDRLASYLEKVRALEEANMKLESRILKWHQQRDPGSKKDYS
QYEENITHLQEQIVDGKMTNAQIILLIDNARMAVDDFNLKYENEHSFKKDLEIEVEGLRR
TLDNLTIVTTDLEQEVEGMRKELILMKKHHEQEMEKHHVPSDFNVNVKVDTGPREDLIKV
LEDMRQEYELIIKKKHRDLDTWYKEQSAAMSQEAASPATVQSRQGDIHELKRTFQALEID
LQTQYSTKSALENMLSETQSRYSCKLQDMQEIISHYEEELTQLRHELERQNNEYQVLLGI
KTHLEKEITTYRRLLEGESEGTREESKSSMKVSATPKIKAITQETINGRLVLCQVNEIQK
HA
NT seq 1269 nt   +upstreamnt  +downstreamnt
atgaactccggacacagcttcagccagaccccctcggcctccttccatggcgccggaggt
ggctggggccggcccaggagcttccccagggctcccaccgtccatggcggtgcgggggga
gcccgcatctccctgtccttcaccacgcggagctgcccaccccctggagggtcttggggt
tctggaagaagcagccccctactaggcggaaatgggaaggccaccatgcagaatctcaac
gaccgcctggcctcctacctggagaaggttcgcgccctggaggaggccaacatgaagctg
gaaagccgcatcctgaaatggcaccagcagagagatcctggcagtaagaaagattattcc
cagtatgaggaaaacatcacacacctgcaggagcagatagtggatggtaagatgaccaat
gctcagattattcttctcattgacaatgccaggatggcagtggatgacttcaacctcaag
tatgaaaatgaacactcctttaagaaagacttggaaattgaagtcgagggcctccgaagg
accttagacaacctgaccattgtcacaacagacctagaacaggaggtggaaggaatgagg
aaagagctcattctcatgaagaagcaccatgagcaggaaatggagaagcatcatgtgcca
agtgacttcaatgtcaatgtgaaggtggatacaggtcccagggaagatctgattaaggtc
ctggaggatatgagacaagaatatgagcttataataaagaagaagcatcgagacttggac
acttggtataaagaacagtctgcagccatgtcccaggaggcagccagtccagccactgtg
cagagcagacaaggtgacatccacgaactgaagcgcacattccaggccctggagattgac
ctgcagacacagtacagcacgaaatctgctttggaaaacatgttatccgagacccagtct
cggtactcctgcaagctccaggacatgcaagagatcatctcccactatgaggaggaactg
acgcagctacgccatgaactggagcggcagaacaatgaataccaagtgctgctgggcatc
aaaacccacctggagaaggaaatcaccacgtaccgacggctcctggagggagagagtgaa
gggacacgggaagaatcaaagtcgagcatgaaagtgtctgcaactccaaagatcaaggcc
ataacccaggagaccatcaacggaagattagttctttgtcaagtgaatgaaatccaaaag
cacgcatga

KEGG   Homo sapiens (human): 342574
Entry
342574            CDS       T01001                                 
Symbol
KRT27, K25IRS3, KRT25C
Name
(RefSeq) keratin 27
  KO
K07604  type I keratin, acidic
Organism
hsa  Homo sapiens (human)
Pathway
hsa04915  Estrogen signaling pathway
hsa05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    342574 (KRT27)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    342574 (KRT27)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    342574 (KRT27)
   04147 Exosome [BR:hsa04147]
    342574 (KRT27)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     342574 (KRT27)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   342574 (KRT27)
  Exosomal proteins of other body fluids (saliva and urine)
   342574 (KRT27)
  Exosomal proteins of colorectal cancer cells
   342574 (KRT27)
  Exosomal proteins of melanoma cells
   342574 (KRT27)
SSDB
Motif
Pfam: Filament TPR_MLP1_2 ATG16
Other DBs
NCBI-GeneID: 342574
NCBI-ProteinID: NP_853515
OMIM: 616676
HGNC: 30841
Ensembl: ENSG00000171446
Pharos: Q7Z3Y8(Tdark)
UniProt: Q7Z3Y8
LinkDB
Position
17:complement(40776808..40782550)
AA seq 459 aa
MSVRFSSTSRRLGSCGGTGSVRLSSGGAGFGAGNTCGVPGIGSGFSCAFGGSSSAGGYGG
GLGGGSASCAAFTGNEHGLLSGNEKVTMQNLNDRLASYLENVRALEEANADLEQKIKGWY
EKFGPGSCRGLDHDYSRYFPIIDELKNQIISATTSNAHVVLQNDNARLTADDFRLKFENE
LALHQSVEADINGLRRVLDELTLCRTDLEIQLETLSEELAYLKKNHEEEMKALQCAAGGN
VNVEMNAAPGVDLTVLLNNMRAEYEALAEQNRRDAEAWFNEKSASLQQQISDDAGATTSA
RNELIEMKRTLQTLEIELQSLLATKHSLECSLTETESNYCAQLAQIQAQIGALEEQLHQV
RTETEGQKLEYEQLLDIKVHLEKEIETYCLLIDGEDGSCSKSKGYGGPGNQTKDSSKTTI
VKTVVEEIDPRGKVLSSRVHTVEEKSTKVNNKNEQRVSS
NT seq 1380 nt   +upstreamnt  +downstreamnt
atgtctgtgcgcttttcttctacctccaggagacttggctcttgcgggggcactggctct
gtgaggctctctagtgggggagcaggctttggggctggaaacacatgcggtgtgccaggc
attggaagtggcttctcttgtgcttttgggggcagctcatctgcaggaggctatggcgga
ggtctgggcgggggaagtgcttcctgtgctgccttcacagggaatgagcacggcctcctc
tctggcaatgagaaggtgaccatgcagaacctcaacgaccgcttggcctcctacctggag
aatgttcgagccctagaggaggccaacgctgacttggagcagaagatcaaggggtggtat
gagaaatttggacctggttcttgccgtggccttgatcatgattacagcagatatttccca
attattgacgaacttaagaaccagataatttctgcaactaccagtaatgcccatgttgtc
ctgcaaaatgataatgcaagactaacagctgatgacttcagactaaagtttgaaaacgag
ctagcgcttcaccagagcgtggaggcggacatcaatggtttgcgaagagtcctggatgag
ctgaccttgtgcagaacggacctggagatccagctggaaactctcagtgaggagctcgct
tacctcaagaagaatcatgaggaggaaatgaaagctcttcagtgcgcggctggaggcaac
gtgaacgtggagatgaacgcggcccccggggtagacctcacggttctgctgaacaatatg
cgagctgagtacgaagccctcgcagagcagaaccgcagggacgcggaggcctggttcaac
gaaaagagcgcctcgctgcagcagcagatctctgacgacgctggcgccaccacctcagcc
cggaatgagcttatcgagatgaaacgcactcttcaaacccttgagattgaacttcagtcc
ctcttagcaacgaaacactccctggagtgctccttgacagagaccgagagtaactactgt
gcacagctggcacagatccaggctcagatcggggccctggaggagcagctgcaccaggtc
agaaccgagaccgagggccagaagctcgagtatgagcagctccttgacatcaaggtccac
ctggaaaaagaaattgagacctactgcctcctgatagatggagaagatggctcctgttct
aaatcaaaaggctatggaggcccaggaaatcaaacaaaagattcatctaaaaccaccatt
gtcaaaacagttgttgaagagatagatcctcgtggcaaagttctctcatccagagttcac
actgtggaagagaaatccaccaaagtcaacaacaagaatgaacagagggtgtcttcctga

KEGG   Homo sapiens (human): 353288
Entry
353288            CDS       T01001                                 
Symbol
KRT26, CK26, K25B, K25IRS2, K26, KRT25B
Name
(RefSeq) keratin 26
  KO
K07604  type I keratin, acidic
Organism
hsa  Homo sapiens (human)
Pathway
hsa04915  Estrogen signaling pathway
hsa05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    353288 (KRT26)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    353288 (KRT26)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    353288 (KRT26)
   04147 Exosome [BR:hsa04147]
    353288 (KRT26)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     353288 (KRT26)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   353288 (KRT26)
  Exosomal proteins of other body fluids (saliva and urine)
   353288 (KRT26)
  Exosomal proteins of colorectal cancer cells
   353288 (KRT26)
  Exosomal proteins of melanoma cells
   353288 (KRT26)
SSDB
Motif
Pfam: Filament TPR_MLP1_2 Prefoldin Bacillus_HBL Phage_Mu_Gam Tropomyosin_1 V_ATPase_I FlxA DUF4407
Other DBs
NCBI-GeneID: 353288
NCBI-ProteinID: NP_853517
OMIM: 616675
HGNC: 30840
Ensembl: ENSG00000186393
Pharos: Q7Z3Y9(Tbio)
UniProt: Q7Z3Y9
LinkDB
Position
17:complement(40766238..40772201)
AA seq 468 aa
MSFRLSGGSRRICSRTGSGRLSGGGTGFVAGNVCVGSGARSSFSCTLEGISSGGSFCNSG
GGLGSGACAGFLGNEHSLLSGNEKVTMQNLNDRLASYLDHVHALEEANADLEQKIKGWYE
KCEPGSSREHDHDYSRYFSVIEDLKRQIISATICNASIVLQNDNARLTADDFRLKYENEL
ALHHSVEADTSGLRRVLDELTLCTTDLEIQCETLSEELTYLKKSHEEEMEVLQYTAGGNV
NVEMNATPGVDLTVLLNNMRAEYEDLAEQNRKDAEAWFNERSATLQQQISDHEGAATAAR
NELTELKRNLQTLEIELQSLMAVKHSYECSLAETEGNYCNQLQQIQDQIGVMEEQLQQIR
TETEGQKLEYEQLLDVKIFLEKEIDIYCNLLDGEERKSKSTCYKSKGYRPVNSGNQAKDS
TEETIVKTVVEELDQIGNLLSLRVHSVEEKSSKISNITVEQRVPSKAP
NT seq 1407 nt   +upstreamnt  +downstreamnt
atgtcttttcgactttctggtggatccaggaggatctgctcgcgaactgggtctggtagg
ctgtccggtggaggaacaggcttcgtggctgggaatgtgtgtgttggatcgggagcaaga
agcagcttttcttgtactcttgagggcatctcttctggaggaagcttctgcaatagcggt
ggagggttgggaagtggtgcctgtgctggttttcttggcaatgagcacagcctcctctct
gggaatgaaaaggtgaccatgcagaatctcaacgaccgcctggcatcctacctggaccat
gtgcatgctctagaggaggccaacgcagacctggagcagaagatcaagggctggtacgag
aaatgtgagcctggctcttcccgggaacacgatcatgactatagcagatacttctcagtc
atagaagatcttaaaaggcagattatttctgcgaccatctgcaatgccagcattgttcta
caaaatgacaatgccagactgaccgctgatgacttcaggctgaagtatgaaaatgagctg
gctctgcaccacagtgttgaggccgacaccagtggtcttcgcagagtgttggatgaactg
accctttgtacaaccgacctggagatacagtgtgagaccctcagtgaggaattgacctac
ctcaaaaaaagtcatgaggaggaaatggaagtcttgcaatatacagctggggggaacgtg
aacgtggagatgaatgcaaccccaggagtggacctaactgtcctgttgaacaacatgagg
gctgagtatgaggacttggctgagcagaaccgcaaagatgctgaagcctggttcaacgag
aggagtgcaacgctgcaacaacagatttccgatcatgagggagcagccacagcagccaga
aatgagctgaccgaattaaaacgcaatctgcaaaccctggaaatagaacttcagtccctc
atggctgtgaaacattcctatgaatgctccttggctgagactgaaggaaattactgcaat
caactccagcaaattcaggatcagataggggtgatggaggaacaactgcaacagattcga
acagaaacagaaggccagaagctggagtatgaacagcttcttgatgtaaaaatattttta
gaaaaagaaattgacatttattgcaacttactagatggagaagaaagaaaaagcaaatcc
acatgttacaaatcaaaaggatacaggcctgtgaattctggaaatcaagccaaagactca
acagaagaaactattgttaaaacagtggttgaggaactggatcaaattggcaatctcctt
tcactgagagtccactcagttgaagaaaagtcctctaaaataagcaacattacagtagag
caacgagtaccttctaaagcaccataa

KEGG   Homo sapiens (human): 3857
Entry
3857              CDS       T01001                                 
Symbol
KRT9, CK-9, EPPK, K9
Name
(RefSeq) keratin 9
  KO
K07604  type I keratin, acidic
Organism
hsa  Homo sapiens (human)
Pathway
hsa04915  Estrogen signaling pathway
hsa05150  Staphylococcus aureus infection
Disease
H00722  Epidermolytic palmoplantar keratoderma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    3857 (KRT9)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    3857 (KRT9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    3857 (KRT9)
   04147 Exosome [BR:hsa04147]
    3857 (KRT9)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     3857 (KRT9)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   3857 (KRT9)
  Exosomal proteins of other body fluids (saliva and urine)
   3857 (KRT9)
  Exosomal proteins of colorectal cancer cells
   3857 (KRT9)
  Exosomal proteins of melanoma cells
   3857 (KRT9)
SSDB
Motif
Pfam: Filament TMF_TATA_bd FlxA Baculo_PEP_C TPR_MLP1_2 Crescentin Myosin_tail_1 CCDC22 UPF0242 Prefoldin_2 RasGAP_C
Other DBs
NCBI-GeneID: 3857
NCBI-ProteinID: NP_000217
OMIM: 607606
HGNC: 6447
Ensembl: ENSG00000171403
Pharos: P35527(Tbio)
UniProt: P35527
LinkDB
Position
17:complement(41565836..41572059)
AA seq 623 aa
MSCRQFSSSYLSRSGGGGGGGLGSGGSIRSSYSRFSSSGGGGGGGRFSSSSGYGGGSSRV
CGRGGGGSFGYSYGGGSGGGFSASSLGGGFGGGSRGFGGASGGGYSSSGGFGGGFGGGSG
GGFGGGYGSGFGGFGGFGGGAGGGDGGILTANEKSTMQELNSRLASYLDKVQALEEANND
LENKIQDWYDKKGPAAIQKNYSPYYNTIDDLKDQIVDLTVGNNKTLLDIDNTRMTLDDFR
IKFEMEQNLRQGVDADINGLRQVLDNLTMEKSDLEMQYETLQEELMALKKNHKEEMSQLT
GQNSGDVNVEINVAPGKDLTKTLNDMRQEYEQLIAKNRKDIENQYETQITQIEHEVSSSG
QEVQSSAKEVTQLRHGVQELEIELQSQLSKKAALEKSLEDTKNRYCGQLQMIQEQISNLE
AQITDVRQEIECQNQEYSLLLSIKMRLEKEIETYHNLLEGGQEDFESSGAGKIGLGGRGG
SGGSYGRGSRGGSGGSYGGGGSGGGYGGGSGSRGGSGGSYGGGSGSGGGSGGGYGGGSGG
GHSGGSGGGHSGGSGGNYGGGSGSGGGSGGGYGGGSGSRGGSGGSHGGGSGFGGESGGSY
GGGEEASGSGGGYGGGSGKSSHS
NT seq 1872 nt   +upstreamnt  +downstreamnt
atgagctgcagacagttctcctcgtcctacttgagccgcagcggcgggggtggcgggggc
ggcctgggcagcgggggcagcataaggtcttcctacagccgcttcagctcctcagggggc
ggtggaggagggggccgattcagctcttctagtggctatggtgggggaagctctcgtgtc
tgtgggaggggaggcggtggcagttttggctacagctacggcggaggatctgggggtggt
tttagtgccagtagtttaggcggtggctttgggggtggttccagaggttttggtggtgct
tctggaggaggctatagtagttctgggggttttggaggtggctttggtggtggttctgga
ggtggctttggtggtggctatgggagtgggtttggggggtttgggggctttggaggtggt
gctggaggaggtgatggtggtattctgactgctaatgagaagagcaccatgcaggaactc
aattctcggctggcctcttacttggataaggtgcaggctctagaggaggccaacaacgac
ctggagaataagatccaggattggtacgacaagaagggacctgctgctatccagaagaac
tactccccttattataacactattgatgatctcaaggaccagattgtggacctgacagtg
ggcaacaacaaaactctcctggacattgacaacactcgcatgacactggatgacttcagg
ataaagtttgagatggagcaaaacctgcggcaaggagtggatgctgacatcaatggcctg
cggcaggtgctggacaatctgaccatggagaagtctgacctggagatgcagtatgagact
ctgcaggaggagctgatggccctcaagaagaatcataaggaggagatgagtcagctgact
gggcagaacagtggagatgtcaatgtggagataaacgttgctcctggcaaagatctcacc
aagaccctcaatgacatgcgtcaggagtatgagcagctcattgctaagaacagaaaggac
atcgagaatcaatatgagactcagataacccagatcgagcatgaggtatccagtagtggt
caggaggtgcagtccagtgccaaggaggtgacccagctccggcacggtgtccaggagttg
gagattgagctgcagtctcagctcagcaagaaagcagctctggagaagagcttggaagac
acgaagaaccgctactgtggccagctgcagatgatccaggagcagatcagtaacttggag
gcccagatcactgacgtccggcaagagatcgagtgccagaatcaggaatacagccttctg
ctcagcattaagatgcggctggagaaggaaatcgagacctaccacaacctccttgaggga
ggccaggaagactttgaatcctccggagctggaaaaattggccttggaggtcgaggagga
agtggaggcagttatggaagaggatccaggggaggaagtggaggcagctatggtggagga
ggaagtggaggtggctatggtggaggaagtgggtccaggggaggaagtggaggcagctac
ggtggaggaagtggttctggaggaggtagtggaggtggctatggtggaggaagtggaggt
ggccatagcggaggaagtggaggtggtcatagtggaggaagtgggggcaactatggagga
ggaagtggctctggaggaggaagtgggggtggctatggtggaggaagtgggtccagggga
ggaagtggaggcagccatggtggaggaagtggttttggaggtgaaagtggaggcagctac
ggaggcggtgaagaagcgagtggaagtggtggcggctacggaggaggaagcggaaaatca
tcccattcctag

KEGG   Homo sapiens (human): 3858
Entry
3858              CDS       T01001                                 
Symbol
KRT10, BCIE, BIE, CK10, EHK, K10, KPP
Name
(RefSeq) keratin 10
  KO
K07604  type I keratin, acidic
Organism
hsa  Homo sapiens (human)
Pathway
hsa04915  Estrogen signaling pathway
hsa05150  Staphylococcus aureus infection
Disease
H00691  Bullous congenital ichthyosiform erythroderma (BCIE)
H00738  Ichthyosis with confetti
H02265  Annular epidermolytic ichthyosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    3858 (KRT10)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    3858 (KRT10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    3858 (KRT10)
   04147 Exosome [BR:hsa04147]
    3858 (KRT10)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     3858 (KRT10)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   3858 (KRT10)
  Exosomal proteins of other body fluids (saliva and urine)
   3858 (KRT10)
  Exosomal proteins of colorectal cancer cells
   3858 (KRT10)
  Exosomal proteins of melanoma cells
   3858 (KRT10)
SSDB
Motif
Pfam: Filament DUF4618 TPR_MLP1_2 APG6_N GAS DUF4407 Jnk-SapK_ap_N DUF1798
Other DBs
NCBI-GeneID: 3858
NCBI-ProteinID: NP_000412
OMIM: 148080
HGNC: 6413
Ensembl: ENSG00000186395
Pharos: P13645(Tbio)
UniProt: P13645
Structure
LinkDB
Position
17:complement(40818117..40822614)
AA seq 584 aa
MSVRYSSSKHYSSSRSGGGGGGGGCGGGGGVSSLRISSSKGSLGGGFSSGGFSGGSFSRG
SSGGGCFGGSSGGYGGLGGFGGGSFRGSYGSSSFGGSYGGIFGGGSFGGGSFGGGSFGGG
GFGGGGFGGGFGGGFGGDGGLLSGNEKVTMQNLNDRLASYLDKVRALEESNYELEGKIKE
WYEKHGNSHQGEPRDYSKYYKTIDDLKNQILNLTTDNANILLQIDNARLAADDFRLKYEN
EVALRQSVEADINGLRRVLDELTLTKADLEMQIESLTEELAYLKKNHEEEMKDLRNVSTG
DVNVEMNAAPGVDLTQLLNNMRSQYEQLAEQNRKDAEAWFNEKSKELTTEIDNNIEQISS
YKSEITELRRNVQALEIELQSQLALKQSLEASLAETEGRYCVQLSQIQAQISALEEQLQQ
IRAETECQNTEYQQLLDIKIRLENEIQTYRSLLEGEGSSGGGGRGGGSFGGGYGGGSSGG
GSSGGGHGGGHGGSSGGGYGGGSSGGGSSGGGYGGGSSSGGHGGSSSGGYGGGSSGGGGG
GYGGGSSGGGSSSGGGYGGGSSSGGHKSSSSGSVGESSSKGPRY
NT seq 1755 nt   +upstreamnt  +downstreamnt
atgtctgttcgatacagctcaagcaagcactactcttcctcccgcagtggaggaggagga
ggaggaggaggatgtggaggaggaggaggagtgtcatccctaagaatttctagcagcaaa
ggctcccttggtggaggatttagctcaggggggttcagtggtggctcttttagccgtggg
agctctggtgggggctgctttgggggctcatcaggtggctatggaggattaggaggtttt
ggtggaggtagctttcgtggaagctatggaagtagcagctttggtgggagttatggaggc
atctttggagggggcagtttcggaggtggcagctttggtgggggcagctttggtggaggc
ggctttggtggaggcggctttggaggaggctttggtggtggatttggaggagatggtggc
cttctctctggaaatgaaaaagtaaccatgcagaatctgaatgaccgcctggcttcctac
ttggacaaagttcgggctctggaagaatcaaactatgagctggaaggcaaaatcaaggag
tggtatgaaaagcatggcaactcacatcagggggagcctcgtgactacagcaaatactac
aaaaccatcgatgaccttaaaaatcagattctcaacctaacaactgataatgccaacatc
ctgcttcagatcgacaatgccaggctggcagctgatgacttcaggctgaagtatgagaat
gaggtagctctgcgccagagcgtggaggctgacatcaacggcctgcgtagggtgctggat
gagctgaccctgaccaaggctgacctggagatgcaaattgagagcctgactgaagagctg
gcctatctgaagaagaaccacgaggaggaaatgaaagaccttcgaaatgtgtccactggt
gatgtgaatgtggaaatgaatgctgccccgggtgttgatctgactcaacttctgaataac
atgagaagccaatatgaacaacttgctgaacaaaaccgcaaagatgctgaagcctggttc
aatgaaaagagcaaggaactgactacagaaattgataataacattgaacagatatccagc
tataaatctgagattactgaattgagacgtaatgtacaagctctggagatagaactacag
tcccaactggccttgaaacaatccctggaagcctccttggcagaaacagaaggtcgctac
tgtgtgcagctctcacagattcaggcccagatatccgctctggaagaacagttgcaacag
attcgagctgaaaccgagtgccagaatactgaataccaacaactcctggatattaagatc
cgactggagaatgaaattcaaacctaccgcagcctgctagaaggagagggaagttccgga
ggcggcggacgcggcggcggaagtttcggcggcggctacggcggcggaagctccggcggc
ggaagctccggcggcggccacggcggcggccacggcggcagttccggcggcggctacgga
ggcggaagctccggcggcggaagctccggcggcggctacgggggcggaagctccagcggc
ggccacggcggcagttccagcggcggctacggtggtggcagttccggcggcggcggcggc
ggctacgggggcggcagctccggcggcggcagcagctccggcggcggatacggcggcggc
agctccagcggaggccacaagtcctcctcttccgggtccgtgggcgagtcttcatctaag
ggaccaagatactaa

DBGET integrated database retrieval system