KEGG   Homo sapiens (human): 10097
Entry
10097             CDS       T01001                                 

Symbol
ACTR2, ARP2
Name
(RefSeq) actin related protein 2
  KO
K17260  actin-related protein 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04530  Tight junction
hsa04666  Fc gamma R-mediated phagocytosis
hsa04810  Regulation of actin cytoskeleton
hsa05100  Bacterial invasion of epithelial cells
hsa05130  Pathogenic Escherichia coli infection
hsa05131  Shigellosis
hsa05132  Salmonella infection
hsa05135  Yersinia infection
Network
nt06135  Cytoskeletal regulation (viruses and bacteria)
  Element
N01066  ARNO-ARF-ACTB_G signaling pathway
N01067  Shigella IpgD to ARNO-ARF-ACTB_G signaling pathway
N01078  EGF-EGFR-Actin signaling pathway
N01079  Shigella IpaC to Actin signaling pathway
N01086  Escherichia EspT to RAC signaling pathway
N01092  Escherichia Eae/Tir to Actin signaling pathway
N01094  Escherichia Eae/Tir/TccP to Actin signaling pathway
N01096  Escherichia Map to CDC42 signaling pathway
N01128  Salmonella SopE to RAC signaling pathway
N01129  Salmonella SopB to ARNO-ARF-ACTB/G signaling pathway
N01287  Tight junction-Actin signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    10097 (ACTR2)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    10097 (ACTR2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    10097 (ACTR2)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    10097 (ACTR2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    10097 (ACTR2)
   05132 Salmonella infection
    10097 (ACTR2)
   05131 Shigellosis
    10097 (ACTR2)
   05135 Yersinia infection
    10097 (ACTR2)
   05100 Bacterial invasion of epithelial cells
    10097 (ACTR2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    10097 (ACTR2)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    10097 (ACTR2)
   04147 Exosome [BR:hsa04147]
    10097 (ACTR2)
Membrane trafficking [BR:hsa04131]
 Others
  Actin-binding proteins
   Arp2/3 complex
    10097 (ACTR2)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Arp2/3 complex
     10097 (ACTR2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   10097 (ACTR2)
  Exosomal proteins of other body fluids (saliva and urine)
   10097 (ACTR2)
  Exosomal proteins of bladder cancer cells
   10097 (ACTR2)
SSDB
Motif
Pfam: Actin
Other DBs
NCBI-GeneID: 10097
NCBI-ProteinID: NP_005713
OMIM: 604221
HGNC: 169
Ensembl: ENSG00000138071
Vega: OTTHUMG00000129540
Pharos: P61160(Tbio)
UniProt: P61160
LinkDB
Position
2p14
AA seq 394 aa
MDSQGRKVVVCDNGTGFVKCGYAGSNFPEHIFPALVGRPIIRSTTKVGNIEIKDLMVGDE
ASELRSMLEVNYPMENGIVRNWDDMKHLWDYTFGPEKLNIDTRNCKILLTEPPMNPTKNR
EKIVEVMFETYQFSGVYVAIQAVLTLYAQGLLTGVVVDSGDGVTHICPVYEGFSLPHLTR
RLDIAGRDITRYLIKLLLLRGYAFNHSADFETVRMIKEKLCYVGYNIEQEQKLALETTVL
VESYTLPDGRIIKVGGERFEAPEALFQPHLINVEGVGVAELLFNTIQAADIDTRSEFYKH
IVLSGGSTMYPGLPSRLERELKQLYLERVLKGDVEKLSKFKIRIEDPPRRKHMVFLGGAV
LADIMKDKDNFWMTRQEYQEKGVRVLEKLGVTVR
NT seq 1185 nt   +upstreamnt  +downstreamnt
atggacagccagggcaggaaggtggtggtgtgcgacaacggcaccgggtttgtgaagtgt
ggatatgcaggctctaactttccagaacacatcttcccagctttggttggaagacctatt
atcagatcaaccaccaaagtgggaaacattgaaatcaaggatcttatggttggtgatgag
gcaagtgaattacgatcaatgttagaagttaactaccctatggaaaatggcatagtacga
aattgggatgacatgaaacacctgtgggactacacatttggaccagagaaacttaatata
gataccagaaattgtaaaatcttactcacagaacctcctatgaacccaaccaaaaacaga
gagaagattgtagaggtaatgtttgaaacttaccagttttccggtgtatatgtagccatc
caggcagttctgactttgtacgctcaaggtttattgactggtgtagtggtagactctgga
gatggtgtgactcacatttgcccagtatatgaaggcttttctctccctcatcttaccagg
agactggatattgctgggagggatataactagatatcttatcaagctacttctgttgcga
ggatacgccttcaaccactctgctgattttgaaacggttcgcatgattaaagaaaaactg
tgttacgtgggatataatattgagcaagagcagaaactggccttagaaaccacagtatta
gttgaatcttatacactcccagatggacgtatcatcaaagttgggggagagagatttgaa
gcaccagaagctttatttcagcctcacttgatcaatgttgaaggagttggtgttgctgaa
ttgctttttaacacaattcaggcagctgacattgataccagatctgaattctacaaacac
attgtgctttctggagggtctactatgtatcctggcctgccatcacggttggaacgagaa
cttaaacagctttacttagaacgagttttgaagggtgatgtggaaaaactttctaaattt
aagatccgcattgaagacccaccccgcagaaagcacatggtattcctgggtggtgcagtt
ctagcggatatcatgaaagacaaagacaacttttggatgacccgacaagagtaccaagaa
aagggtgtccgtgtgctagagaaacttggtgtgactgttcgataa

DBGET integrated database retrieval system