KEGG   Homo sapiens (human): 10148
Entry
10148             CDS       T01001                                 

Symbol
EBI3, IL-27B, IL27B, IL35B
Name
(RefSeq) Epstein-Barr virus induced 3
  KO
K24476  interleukin 27 subunit beta
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04659  Th17 cell differentiation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    10148 (EBI3)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    10148 (EBI3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    10148 (EBI3)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Interleukins
   10148 (EBI3)
SSDB
Motif
Pfam: fn3 IL12p40_C
Other DBs
NCBI-GeneID: 10148
NCBI-ProteinID: NP_005746
OMIM: 605816
HGNC: 3129
Ensembl: ENSG00000105246
Vega: OTTHUMG00000181866
Pharos: Q14213(Tbio)
UniProt: Q14213
LinkDB
Position
19p13.3
AA seq 229 aa
MTPQLLLALVLWASCPPCSGRKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPV
SFIATYRLGMAARGHSWPCLQQTPTSTSCTITDVQLFSMAPYVLNVTAVHPWGSSSSFVP
FITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRV
GPIEATSFILRAVRPRARYYVQVAAQDLTDYGELSDWSLPATATMSLGK
NT seq 690 nt   +upstreamnt  +downstreamnt
atgaccccgcagcttctcctggcccttgtcctctgggccagctgcccgccctgcagtgga
aggaaagggcccccagcagctctgacactgccccgggtgcaatgccgagcctctcggtac
ccgatcgccgtggattgctcctggaccctgccgcctgctccaaactccaccagccccgtg
tccttcattgccacgtacaggctcggcatggctgcccggggccacagctggccctgcctg
cagcagacgccaacgtccaccagctgcaccatcacggatgtccagctgttctccatggct
ccctacgtgctcaatgtcaccgccgtccacccctggggctccagcagcagcttcgtgcct
ttcataacagagcacatcatcaagcccgaccctccagaaggcgtgcgcctaagccccctc
gctgagcgccagctacaggtgcagtgggagcctcccgggtcctggcccttcccagagatc
ttctcactgaagtactggatccgttacaagcgtcagggagctgcgcgcttccaccgggtg
gggcccattgaagccacgtccttcatcctcagggctgtgcggccccgagccaggtactac
gtccaagtggcggctcaggacctcacagactacggggaactgagtgactggagtctcccc
gccactgccacaatgagcctgggcaagtag

KEGG   Homo sapiens (human): 246778
Entry
246778            CDS       T01001                                 

Symbol
IL27, IL-27, IL-27A, IL27A, IL27p28, IL30, p28
Name
(RefSeq) interleukin 27
  KO
K22629  interleukin 27 subunit alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04659  Th17 cell differentiation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    246778 (IL27)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    246778 (IL27)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    246778 (IL27)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Interleukins
   246778 (IL27)
SSDB
Other DBs
NCBI-GeneID: 246778
NCBI-ProteinID: NP_663634
OMIM: 608273
HGNC: 19157
Ensembl: ENSG00000197272
Vega: OTTHUMG00000097023
Pharos: Q8NEV9(Tbio)
UniProt: Q8NEV9
LinkDB
Position
16p12.1-p11.2
AA seq 243 aa
MGQTAGDLGWRLSLLLLPLLLVQAGVWGFPRPPGRPQLSLQELRREFTVSLHLARKLLSE
VRGQAHRFAESHLPGVNLYLLPLGEQLPDVSLTFQAWRRLSDPERLCFISTTLQPFHALL
GGLGTQGRWTNMERMQLWAMRLDLRDLQRHLRFQVLAAGFNLPEEEEEEEEEEEEERKGL
LPGALGSALQGPAQVSWPQLLSTYRLLHSLELVLSRAVRELLLLSKAGHSVWPLGFPTLS
PQP
NT seq 732 nt   +upstreamnt  +downstreamnt
atgggccagacggcaggcgaccttggctggcggctcagcctgttgctgcttcccttgctc
ctggttcaagctggtgtctggggattcccaaggcccccagggaggccccagctgagcctg
caggagctgcggagggagttcacagtcagcctgcatctcgccaggaagctgctctccgag
gttcggggccaggcccaccgctttgcggaatctcacctgccaggagtgaacctgtacctc
ctgcccctgggagagcagctccctgatgtttccctgaccttccaggcctggcgccgcctc
tctgacccggagcgtctctgcttcatctccaccacgcttcagcccttccatgccctgctg
ggagggctggggacccagggccgctggaccaacatggagaggatgcagctgtgggccatg
aggctggacctccgcgatctgcagcggcacctccgcttccaggtgctggctgcaggattc
aacctcccggaggaggaggaggaggaagaggaggaggaggaggaggagaggaaggggctg
ctcccaggggcactgggcagcgccttacagggcccggcccaggtgtcctggccccagctc
ctctccacctaccgcctgctgcactccttggagctcgtcttatctcgggccgtgcgggag
ttgctgctgctgtccaaggctgggcactcagtctggcccttggggttcccaacattgagc
ccccagccctga

DBGET integrated database retrieval system