Homo sapiens (human): 101927180 Help Entry 101927180         CDS       T01001                                  Symbol ATP6V1FP2 Name (RefSeq) V-type proton ATPase subunit F-like   KO K02151   V-type H+-transporting ATPase subunit F Organism hsa  Homo sapiens (human) Pathway hsa00190   Oxidative phosphorylation hsa01100   Metabolic pathways hsa04145   Phagosome hsa04150   mTOR signaling pathway hsa04721   Synaptic vesicle cycle hsa04966   Collecting duct acid secretion hsa05110   Vibrio cholerae infection hsa05120   Epithelial cell signaling in Helicobacter pylori infection hsa05165   Human papillomavirus infection hsa05323   Rheumatoid arthritis Module hsa_M00160   V-type ATPase, eukaryotes Brite KEGG Orthology (KO) [BR:hsa00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     101927180 (ATP6V1FP2)  09130 Environmental Information Processing   09132 Signal transduction    04150 mTOR signaling pathway     101927180 (ATP6V1FP2)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     101927180 (ATP6V1FP2)  09150 Organismal Systems   09155 Excretory system    04966 Collecting duct acid secretion     101927180 (ATP6V1FP2)   09156 Nervous system    04721 Synaptic vesicle cycle     101927180 (ATP6V1FP2)  09160 Human Diseases   09172 Infectious disease: viral    05165 Human papillomavirus infection     101927180 (ATP6V1FP2)   09171 Infectious disease: bacterial    05110 Vibrio cholerae infection     101927180 (ATP6V1FP2)    05120 Epithelial cell signaling in Helicobacter pylori infection     101927180 (ATP6V1FP2)   09163 Immune disease    05323 Rheumatoid arthritis     101927180 (ATP6V1FP2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_F Myb_Cef Motif Other DBs NCBI-GeneID:  101927180 NCBI-ProteinID:  XP_047285908 LinkDB All DBs Position 12:48084454..48087173 Genome browser AA seq 119 aa AA seqDB search MAGRRKLIAVIRDKDTVTGFLLGSIGELNKNCHPNFLVVEKDTTINEIEDTFRQFLNRDD TGIILINQYIAEMVQHALDTHQHSIPTVLEIPSKEHPYEDAKDSTLRRARGMFTAEDLC NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggcggggagaaggaagctcatcgcagtgatcagagacaaggacacggtgactggtttc ctgctgggcagcataggggagcttaacaagaactgccaccccaatttcctggtggtggag aaggatacgaccatcaatgagatcgaagacactttccggcaatttctaaaccgggatgac actggcatcatcctcatcaaccagtacatcgcagagatggtgcagcatgccctggacacc caccagcactctatccctactgtcctggagatcccctccaaggagcacccatatgaggac gccaaggactccaccctgcggagggccaggggcatgttcactgccgaagacctgtgctag

Homo sapiens (human): 9296 Help Entry 9296              CDS       T01001                                  Symbol ATP6V1F, ATP6S14, VATF, Vma7 Name (RefSeq) ATPase H+ transporting V1 subunit F   KO K02151   V-type H+-transporting ATPase subunit F Organism hsa  Homo sapiens (human) Pathway hsa00190   Oxidative phosphorylation hsa01100   Metabolic pathways hsa04145   Phagosome hsa04150   mTOR signaling pathway hsa04721   Synaptic vesicle cycle hsa04966   Collecting duct acid secretion hsa05110   Vibrio cholerae infection hsa05120   Epithelial cell signaling in Helicobacter pylori infection hsa05165   Human papillomavirus infection hsa05323   Rheumatoid arthritis Module hsa_M00160   V-type ATPase, eukaryotes Brite KEGG Orthology (KO) [BR:hsa00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     9296 (ATP6V1F)  09130 Environmental Information Processing   09132 Signal transduction    04150 mTOR signaling pathway     9296 (ATP6V1F)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     9296 (ATP6V1F)  09150 Organismal Systems   09155 Excretory system    04966 Collecting duct acid secretion     9296 (ATP6V1F)   09156 Nervous system    04721 Synaptic vesicle cycle     9296 (ATP6V1F)  09160 Human Diseases   09172 Infectious disease: viral    05165 Human papillomavirus infection     9296 (ATP6V1F)   09171 Infectious disease: bacterial    05110 Vibrio cholerae infection     9296 (ATP6V1F)    05120 Epithelial cell signaling in Helicobacter pylori infection     9296 (ATP6V1F)   09163 Immune disease    05323 Rheumatoid arthritis     9296 (ATP6V1F) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_F Motif Other DBs NCBI-GeneID:  9296 NCBI-ProteinID:  NP_004222 OMIM:  607160 HGNC:  16832 Ensembl:  ENSG00000128524 Pharos:  Q16864(Tbio) UniProt:  Q16864 A4D1K0 Structure PDBPDBj LinkDB All DBs Position 7:128862856..128865847 Genome browser AA seq 119 aa AA seqDB search MAGRGKLIAVIGDEDTVTGFLLGGIGELNKNRHPNFLVVEKDTTINEIEDTFRQFLNRDD IGIILINQYIAEMVRHALDAHQQSIPAVLEIPSKEHPYDAAKDSILRRARGMFTAEDLR NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggcggggaggggtaagctcatcgcagtgatcggagacgaggacacggtgactggtttc ctgctgggcggcataggggagcttaacaagaaccgccatcccaatttcctggtggtggag aaggatacaaccatcaatgagatcgaagacactttccggcaatttctaaaccgggatgac attggcatcatcctcatcaaccagtacatcgcagagatggtgcggcatgccctggacgcc caccagcagtccatccccgctgtcctggagatcccctccaaggagcacccatatgacgcc gccaaggactccatcctgcgcagggccaggggcatgttcactgccgaagacctgcgctag

DBGET integrated database retrieval system