KEGG   Homo sapiens (human): 10262
Entry
10262             CDS       T01001                                 
Symbol
SF3B4, AFD1, Hsh49, SAP49, SF3b49
Name
(RefSeq) splicing factor 3b subunit 4
  KO
K12831  splicing factor 3B subunit 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
Disease
H01376  Acrofacial dysostosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    10262 (SF3B4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    10262 (SF3B4)
Spliceosome [BR:hsa03041]
 Complex A
  U2 snRNP components
   U2 snRNP specific factors
    10262 (SF3B4)
 Complex B
    10262 (SF3B4)
 Complex C
   U2 SnRNP specific factors
    10262 (SF3B4)
SSDB
Motif
Pfam: RRM_1 RRM_7 OB_RNB
Other DBs
NCBI-GeneID: 10262
NCBI-ProteinID: NP_005841
OMIM: 605593
HGNC: 10771
Ensembl: ENSG00000143368
Pharos: Q15427(Tbio)
UniProt: Q15427 B3KUJ0
Structure
LinkDB
Position
1:complement(149923317..149927803)
AA seq 424 aa
MAAGPISERNQDATVYVGGLDEKVSEPLLWELFLQAGPVVNTHMPKDRVTGQHQGYGFVE
FLSEEDADYAIKIMNMIKLYGKPIRVNKASAHNKNLDVGANIFIGNLDPEIDEKLLYDTF
SAFGVILQTPKIMRDPDTGNSKGYAFINFASFDASDAAIEAMNGQYLCNRPITVSYAFKK
DSKGERHGSAAERLLAAQNPLSQADRPHQLFADAPPPPSAPNPVVSSLGSGLPPPGMPPP
GSFPPPVPPPGALPPGIPPAMPPPPMPPGAAGHGPPSAGTPGAGHPGHGHSHPHPFPPGG
MPHPGMSQMQLAHHGPHGLGHPHAGPPGSGGQPPPRPPPGMPHPGPPPMGMPPRGPPFGS
PMGHPGPMPPHGMRGPPPLMPPHGYTGPPRPPPYGYQRGPLPPPRPTPRPPVPPRGPLRG
PLPQ
NT seq 1275 nt   +upstreamnt  +downstreamnt
atggctgccgggccgatctccgagcggaatcaggatgccactgtgtacgtggggggcctg
gatgagaaggttagtgaaccgctgctgtgggaactgtttctccaggctggaccagtagtc
aacacccacatgccaaaggatagagtcactggccagcaccaaggctatggctttgtggaa
ttcttgagtgaggaagatgctgactatgccattaagatcatgaacatgatcaaactctat
gggaagccaatacgggtgaacaaagcatcagctcacaacaaaaacctggatgtaggggcc
aacattttcattgggaacctggaccctgagattgatgagaagttgctttatgatactttc
agcgcctttggggtcatcttacaaacccccaaaattatgcgggaccctgacacaggcaac
tccaaaggttatgcctttattaattttgcttcatttgatgcttcggatgcagcaattgaa
gccatgaatgggcagtacctctgtaaccgtcctatcaccgtatcttatgccttcaagaag
gactccaagggtgagcgccatggctcagcagccgaacgacttctggcagctcagaacccg
ctctcccaggctgatcgccctcatcagctgtttgcagatgcacctcctccaccctctgct
cccaatcctgtggtatcatcattggggtctgggcttcctccaccaggcatgcctcctcct
ggctccttcccacccccagtgccacctcctggagccctcccacctgggatacccccagcc
atgcccccaccacctatgcctcctggggctgcaggacatggccccccatcggcaggaacc
ccaggggcaggacatcctggtcatggacactcacatcctcacccattcccaccgggtggg
atgccccatccagggatgtctcagatgcagcttgcacaccatggccctcatggcttagga
catccccacgctggacccccaggctctgggggccagccaccgccccgaccaccacctgga
atgcctcatcctggacctcctccaatgggcatgcccccccgagggcctccattcggatct
cccatgggtcacccaggtcctatgcctccgcatggtatgcgtggacctcctccactgatg
cccccccatggatacactggccctccacgacccccaccctatggctaccagcgggggcct
ctccctccacccagacccactccccggccaccagttccccctcgaggcccacttcgaggc
cctctccctcagtaa

KEGG   Homo sapiens (human): 10992
Entry
10992             CDS       T01001                                 
Symbol
SF3B2, CFM, Cus1, SAP145, SF3B145, SF3b1, SF3b150
Name
(RefSeq) splicing factor 3b subunit 2
  KO
K12829  splicing factor 3B subunit 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    10992 (SF3B2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    10992 (SF3B2)
Spliceosome [BR:hsa03041]
 Complex A
  U2 snRNP components
   U2 snRNP specific factors
    10992 (SF3B2)
 Complex B
    10992 (SF3B2)
 Complex C
   U2 SnRNP specific factors
    10992 (SF3B2)
SSDB
Motif
Pfam: DUF382 PSP SAP
Other DBs
NCBI-GeneID: 10992
NCBI-ProteinID: NP_006833
OMIM: 605591
HGNC: 10769
Ensembl: ENSG00000087365
Pharos: Q13435(Tbio)
UniProt: Q13435
Structure
LinkDB
Position
11:66052364..66069308
AA seq 895 aa
MATEHPEPPKAELQLPPPPPPGHYGAWAAQELQAKLAEIGAPIQGNREELVERLQSYTRQ
TGIVLNRPVLRGEDGDKAAPPPMSAQLPGIPMPPPPLGLPPLQPPPPPPPPPPGLGLGFP
MAHPPNLGPPPPLRVGEPVALSEEERLKLAQQQAALLMQQEERAKQQGDHSLKEHELLEQ
QKRAAVLLEQERQQEIAKMGTPVPRPPQDMGQIGVRTPLGPRVAAPVGPVGPTPTVLPMG
APVPRPRGPPPPPGDENREMDDPSVGPKIPQALEKILQLKESRQEEMNSQQEEEEMETDA
RSSLGQSASETEEDTVSVSKKEKNRKRRNRKKKKKPQRVRGVSSESSGDREKDSTRSRGS
DSPAADVEIEYVTEEPEIYEPNFIFFKRIFEAFKLTDDVKKEKEKEPEKLDKLENSAAPK
KKGFEEEHKDSDDDSSDDEQEKKPEAPKLSKKKLRRMNRFTVAELKQLVARPDVVEMHDV
TAQDPKLLVHLKATRNSVPVPRHWCFKRKYLQGKRGIEKPPFELPDFIKRTGIQEMREAL
QEKEEQKTMKSKMREKVRPKMGKIDIDYQKLHDAFFKWQTKPKLTIHGDLYYEGKEFETR
LKEKKPGDLSDELRISLGMPVGPNAHKVPPPWLIAMQRYGPPPSYPNLKIPGLNSPIPES
CSFGYHAGGWGKPPVDETGKPLYGDVFGTNAAEFQTKTEEEEIDRTPWGELEPSDEESSE
EEEEEESDEDKPDETGFITPADSGLITPGGFSSVPAGMETPELIELRKKKIEEAMDGSET
PQLFTVLPEKRTATVGGAMMGSTHIYDMSTVMSRKGPAPELQGVEVALAPEELELDPMAM
TQKYEEHVREQQAQVEKEDFSDMVAEHAAKQKQKKRKAQPQDSRGGSKKYKEFKF
NT seq 2688 nt   +upstreamnt  +downstreamnt
atggcgacggagcatcccgagcctcccaaagcagaattgcagctgccgccgccgccacct
ccaggccactatggcgcctgggctgcccaggagcttcaggccaagttggcagagatcgga
gctccgatccagggtaatcgcgaggagctggtggagcggctgcagagctacacccgccag
actggcatcgtgctgaatcggccggttttgagaggggaagatggggacaaagccgctcca
cctcccatgtcggcacagctccctggaattcccatgccaccaccacctttgggactcccc
cctctgcagcctcctccgccacccccaccacctccaccaggccttggccttggctttcct
atggcccacccaccaaatttggggcccccgcctcctctccgtgtgggtgagccagtggca
ctgtcagaggaggagcggctgaagttggctcagcagcaggcggcattgctgatgcagcag
gaggagcgtgccaagcagcagggagatcattcgctgaaggaacatgagctcttggagcag
cagaagcgggcagctgtgttactggagcaggaacgacagcaggagattgccaagatgggc
accccagtccctcggcccccacaagacatgggccagattggtgtgcgcactcctctgggt
cctcgagtagctgctccagtgggcccagtgggccccactcctacagttttgcccatggga
gcccctgttccccggcctcgtggtcccccaccgccccctggagatgagaacagagagatg
gatgacccctctgtgggccccaagatcccccaggctttggagaagatcctgcagctgaag
gagagccgccaggaagagatgaattctcagcaggaggaagaggaaatggaaacagatgct
cgctcgtccctgggccagtcagcgtcagagactgaggaggacacagtgtccgtatctaaa
aaggagaaaaaccggaagcgtaggaaccgaaagaagaagaaaaagccccagcgggtgcga
ggggtgtcctctgagagctctggggaccgggagaaagactcaacccggtcccgtggctct
gattccccagcagctgatgttgagattgagtatgtgactgaagaacctgaaatttacgag
cccaactttatcttctttaagaggatctttgaggcttttaagctcactgatgatgtgaag
aaggagaaagagaaggagccagagaaacttgacaaactggagaactctgcagcccccaag
aagaagggatttgaagaggagcacaaggacagtgatgatgacagcagtgatgacgagcag
gaaaagaagccagaagcccccaagctgtccaagaagaagttgcgccgaatgaaccgcttc
actgtggctgaactcaagcagctggtggctcggcccgatgtcgtggagatgcacgatgtg
acagcgcaggaccctaagctcttggttcacctcaaggccactcggaactctgtgcctgtg
ccacgccactggtgttttaagcgcaaatacctgcagggcaaacggggcattgagaagccc
cccttcgagctgccagacttcatcaaacgcacaggcatccaggagatgcgagaggccctg
caggagaaggaagaacagaagaccatgaagtcaaaaatgcgagagaaagttcggcctaag
atgggcaaaattgacatcgactaccagaaactgcatgatgccttcttcaagtggcagacc
aagccaaagctgaccatccatggggacctgtactatgaggggaaggagttcgagacacga
ctgaaggagaagaagccaggagatctgtctgatgagctaaggatttccttggggatgcca
gtaggaccaaatgcccacaaggtccctcccccatggctgattgccatgcagcgatatgga
ccacccccatcgtatcccaacctgaaaatccctgggctgaactcgcccatccctgagagc
tgttcctttgggtaccatgctggtggctggggcaaacctccagtggatgagactgggaaa
ccgctctatggggacgtgtttggaaccaatgctgctgaatttcagaccaagactgaggaa
gaagagattgatcggaccccttggggggaactggaaccatctgatgaagaatcctcagaa
gaagaggaagaggaagaaagtgatgaagacaaaccagatgagacaggctttattacccct
gcagacagtggccttatcactcctggaggcttttcatcagtgcctgctggaatggagacc
cctgaactcattgagctgaggaagaagaagattgaggaggcgatggacggaagtgagaca
cctcagctcttcactgtgttgccagagaagagaacagccactgttggaggggccatgatg
ggatcaacccacatttatgacatgtccacggttatgagccggaagggcccggctcctgag
ctgcaaggtgtggaagtggcgctggcgcctgaagagttggagctggatcctatggccatg
acccagaagtatgaggagcatgtgcgggagcagcaggctcaagtagagaaggaggacttc
agtgacatggtggctgagcacgctgccaaacagaagcaaaaaaaacggaaagctcagccc
caggacagccgtgggggcagcaagaaatataaggagttcaagttttag

KEGG   Homo sapiens (human): 11325
Entry
11325             CDS       T01001                                 
Symbol
DDX42, DDX42P, RHELP, RNAHP, SF3B8, SF3b125
Name
(RefSeq) DEAD-box helicase 42
  KO
K12835  ATP-dependent RNA helicase DDX42 [EC:3.6.4.13]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    11325 (DDX42)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    11325 (DDX42)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     11325 (DDX42)
Spliceosome [BR:hsa03041]
 Complex A
  U2 snRNP components
   U2 snRNP specific factors
    11325 (DDX42)
 Complex B
    11325 (DDX42)
 Complex C
   U2 SnRNP specific factors
    11325 (DDX42)
SSDB
Motif
Pfam: DEAD Helicase_C ResIII ERCC3_RAD25_C SNF2-rel_dom
Other DBs
NCBI-GeneID: 11325
NCBI-ProteinID: NP_031398
OMIM: 613369
HGNC: 18676
Ensembl: ENSG00000198231
Pharos: Q86XP3(Tdark)
UniProt: Q86XP3
LinkDB
Position
17:63773800..63819317
AA seq 938 aa
MNWNKGGPGTKRGFGFGGFAISAGKKEEPKLPQQSHSAFGATSSSSGFGKSAPPQLPSFY
KIGSKRANFDEENAYFEDEEEDSSNVDLPYIPAENSPTRQQFHSKPVDSDSDDDPLEAFM
AEVEDQAARDMKRLEEKDKERKNVKGIRDDIEEEDDQEAYFRYMAENPTAGVVQEEEEDN
LEYDSDGNPIAPTKKIIDPLPPIDHSEIDYPPFEKNFYNEHEEITNLTPQQLIDLRHKLN
LRVSGAAPPRPGSSFAHFGFDEQLMHQIRKSEYTQPTPIQCQGVPVALSGRDMIGIAKTG
SGKTAAFIWPMLIHIMDQKELEPGDGPIAVIVCPTRELCQQIHAECKRFGKAYNLRSVAV
YGGGSMWEQAKALQEGAEIVVCTPGRLIDHVKKKATNLQRVSYLVFDEADRMFDMGFEYQ
VRSIASHVRPDRQTLLFSATFRKKIEKLARDILIDPIRVVQGDIGEANEDVTQIVEILHS
GPSKWNWLTRRLVEFTSSGSVLLFVTKKANAEELANNLKQEGHNLGLLHGDMDQSERNKV
ISDFKKKDIPVLVATDVAARGLDIPSIKTVINYDVARDIDTHTHRIGRTGRAGEKGVAYT
LLTPKDSNFAGDLVRNLEGANQHVSKELLDLAMQNAWFRKSRFKGGKGKKLNIGGGGLGY
RERPGLGSENMDRGNNNVMSNYEAYKPSTGAMGDRLTAMKAAFQSQYKSHFVAASLSNQK
AGSSAAGASGWTSAGSLNSVPTNSAQQGHNSPDSPVTSAAKGIPGFGNTGNISGAPVTYP
SAGAQGVNNTASGNNSREGTGGSNGKRERYTENRGSSRHSHGETGNRHSDSPRHGDGGRH
GDGYRHPESSSRHTDGHRHGENRHGGSAGRHGENRGANDGRNGESRKEAFNRESKMEPKM
EPKVDSSKMDKVDSKTDKTADGFAVPEPPKRKKSRWDS
NT seq 2817 nt   +upstreamnt  +downstreamnt
atgaactggaataaaggtggtcctggcactaagcgaggatttggctttggaggttttgcc
atcagtgctgggaaaaaggaggaacccaaactcccacagcagtcccacagtgcctttggg
gcaaccagctcttcttctggatttggaaagtcagctccaccacagcttccttctttctac
aaaattggatctaagcgggccaactttgatgaagaaaatgcctattttgaagatgaggaa
gaagattctagcaacgttgatttaccttacattcctgctgaaaactcaccaactcgccag
caattccattccaagccagtagattctgacagcgatgatgatcccttggaggcattcatg
gctgaagtggaggatcaggcagctagagacatgaagaggcttgaagaaaaggacaaggaa
agaaaaaacgtaaagggtattcgagatgacattgaagaggaagatgaccaagaagcttat
tttcgatacatggcagaaaacccaactgctggtgtggttcaggaggaagaggaagacaat
ctagaatatgatagtgacggaaatccaattgcacctaccaaaaaaatcattgatcctctt
ccccccattgatcattcagagattgactatccaccatttgaaaaaaacttttacaatgag
catgaagagataaccaacctcactccacagcagttaatagatctccggcataagctcaat
cttcgggtctctggtgctgcacctcctagaccaggaagtagctttgctcattttgggttt
gacgaacaacttatgcaccagattcggaaatctgaatacacacagcccactccaatacag
tgccagggtgtgcctgtggcattaagtggtagagacatgattggtattgccaaaacaggt
agtgggaaaactgcagccttcatttggcccatgttgattcatataatggaccagaaggag
ttggaaccaggtgatggaccaattgcagtgattgtgtgtcctaccagggagctttgccag
cagatccatgcagaatgtaagcggtttggaaaagcatataatcttcgatcagtggccgta
tatggaggagggagtatgtgggagcaggccaaggcccttcaggagggggcagagattgtt
gtgtgtaccccaggtcgactgatagatcatgtgaaaaagaaagctaccaatcttcaaaga
gtctcttaccttgtgtttgatgaagcagatcgaatgtttgacatgggatttgagtaccaa
gttcgatccatagcaagtcatgttcgtcctgacaggcagactctcttatttagtgcaact
tttcggaagaagattgaaaagttggccagagacatcctgatcgaccctattcgagtggtg
cagggagatattggagaggcaaatgaagatgtgacacagattgtggagattctccattct
ggacctagtaaatggaactggcttacccggcgtctggtagaatttacctcttcagggagt
gtcctcctctttgttactaaaaaagccaatgctgaagagctagcgaataaccttaaacag
gagggtcataatcttgggctgctccatggggatatggatcagagtgagagaaacaaggtc
atttcagactttaagaaaaaggacatcccagtcctggtggccacagatgttgcagcccgt
ggtctggacattccttcaattaagactgtcattaactatgatgtggcacgagacattgat
acccacacgcataggattggccgcacaggaagagcgggtgagaaaggtgtggcctatacc
ctactcactcccaaggacagcaattttgctggtgacctggtccggaacttggaaggagcc
aatcaacacgtttctaaggaactcctagatctggcaatgcagaatgcctggtttcggaaa
tctcgattcaaaggagggaaaggaaaaaagctgaacattggtggaggaggcctaggctac
agggagcggcctggcctgggctctgagaacatggatcgaggaaataacaatgtaatgagc
aattatgaggcctacaagccttccacaggagctatgggagatcgactaacggcaatgaaa
gcagctttccagtcacagtacaagagtcactttgttgcagccagtttaagtaatcagaag
gctggaagttctgctgctggggcaagtgggtggactagtgcagggagcttgaattctgtt
ccaactaactcagcacaacagggccataacagtcctgacagccccgtcaccagtgccgcc
aagggcatcccaggctttggcaatactggcaacatcagtggtgcccctgtgacctacccg
tctgccggagcccaaggagtcaacaacacagcttcagggaataacagccgagaagggact
gggggcagcaacgggaaaagagagagatatactgagaaccggggcagcagccgtcacagt
cacggagagactggcaatcggcatagcgatagtccacgtcacggagatggtggtcgccat
ggagatggataccgccatccagaaagcagcagccgtcatactgatggccatcggcacggg
gagaacagacatggaggaagcgcaggccggcatggggagaaccggggtgcaaatgatggt
cggaatggggaaagcaggaaagaagcttttaatcgtgagagcaagatggagcccaagatg
gaacccaaagtggacagcagcaagatggacaaggtggacagcaagacagataagacagct
gacggctttgctgtcccagagccgcctaaacgcaagaaaagtcgatgggacagttag

KEGG   Homo sapiens (human): 23450
Entry
23450             CDS       T01001                                 
Symbol
SF3B3, RSE1, SAP130, SF3b130, STAF130
Name
(RefSeq) splicing factor 3b subunit 3
  KO
K12830  splicing factor 3B subunit 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    23450 (SF3B3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    23450 (SF3B3)
   03041 Spliceosome [BR:hsa03041]
    23450 (SF3B3)
   03036 Chromosome and associated proteins [BR:hsa03036]
    23450 (SF3B3)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     23450 (SF3B3)
Spliceosome [BR:hsa03041]
 Complex A
  U2 snRNP components
   U2 snRNP specific factors
    23450 (SF3B3)
 Complex B
    23450 (SF3B3)
 Complex C
   U2 SnRNP specific factors
    23450 (SF3B3)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    STAGA complex
     23450 (SF3B3)
    TFTC complex
     23450 (SF3B3)
SSDB
Motif
Pfam: MMS1_N CPSF_A
Other DBs
NCBI-GeneID: 23450
NCBI-ProteinID: NP_036558
OMIM: 605592
HGNC: 10770
Ensembl: ENSG00000189091
Pharos: Q15393(Tchem)
UniProt: Q15393 A8K6V3
Structure
LinkDB
Position
16:70523816..70577668
AA seq 1217 aa
MFLYNLTLQRATGISFAIHGNFSGTKQQEIVVSRGKILELLRPDPNTGKVHTLLTVEVFG
VIRSLMAFRLTGGTKDYIVVGSDSGRIVILEYQPSKNMFEKIHQETFGKSGCRRIVPGQF
LAVDPKGRAVMISAIEKQKLVYILNRDAAARLTISSPLEAHKANTLVYHVVGVDVGFENP
MFACLEMDYEEADNDPTGEAAANTQQTLTFYELDLGLNHVVRKYSEPLEEHGNFLITVPG
GSDGPSGVLICSENYITYKNFGDQPDIRCPIPRRRNDLDDPERGMIFVCSATHKTKSMFF
FLAQTEQGDIFKITLETDEDMVTEIRLKYFDTVPVAAAMCVLKTGFLFVASEFGNHYLYQ
IAHLGDDDEEPEFSSAMPLEEGDTFFFQPRPLKNLVLVDELDSLSPILFCQIADLANEDT
PQLYVACGRGPRSSLRVLRHGLEVSEMAVSELPGNPNAVWTVRRHIEDEFDAYIIVSFVN
ATLVLSIGETVEEVTDSGFLGTTPTLSCSLLGDDALVQVYPDGIRHIRADKRVNEWKTPG
KKTIVKCAVNQRQVVIALTGGELVYFEMDPSGQLNEYTERKEMSADVVCMSLANVPPGEQ
RSRFLAVGLVDNTVRIISLDPSDCLQPLSMQALPAQPESLCIVEMGGTEKQDELGERGSI
GFLYLNIGLQNGVLLRTVLDPVTGDLSDTRTRYLGSRPVKLFRVRMQGQEAVLAMSSRSW
LSYSYQSRFHLTPLSYETLEFASGFASEQCPEGIVAISTNTLRILALEKLGAVFNQVAFP
LQYTPRKFVIHPESNNLIIIETDHNAYTEATKAQRKQQMAEEMVEAAGEDERELAAEMAA
AFLNENLPESIFGAPKAGNGQWASVIRVMNPIQGNTLDLVQLEQNEAAFSVAVCRFSNTG
EDWYVLVGVAKDLILNPRSVAGGFVYTYKLVNNGEKLEFLHKTPVEEVPAAIAPFQGRVL
IGVGKLLRVYDLGKKKLLRKCENKHIANYISGIQTIGHRVIVSDVQESFIWVRYKRNENQ
LIIFADDTYPRWVTTASLLDYDTVAGADKFGNICVVRLPPNTNDEVDEDPTGNKALWDRG
LLNGASQKAEVIMNYHVGETVLSLQKTTLIPGGSESLVYTTLSGGIGILVPFTSHEDHDF
FQHVEMHLRSEHPPLCGRDHLSFRSYYFPVKNVIDGDLCEQFNSMEPNKQKNVSEELDRT
PPEVSKKLEDIRTRYAF
NT seq 3654 nt   +upstreamnt  +downstreamnt
atgtttctgtacaacttaaccttgcagagagccactggcatcagctttgccattcatgga
aacttttctggaaccaaacaacaagaaattgttgtttcccgtgggaagatcttggagctg
cttcgcccagaccccaacactggcaaagtacataccctactcactgtggaagtattcggt
gttatccggtcactcatggcctttaggctgacaggtggcaccaaagactacattgtagtt
ggcagtgactctggtcgaattgttattttggaataccagccatctaagaatatgtttgag
aagattcaccaagaaacctttggcaagagtggatgccgtcgcatcgttcctggccagttc
ttagctgtggatcccaaagggcgagccgttatgattagtgccattgagaaacagaaattg
gtgtatattttgaacagagatgctgcagcccgacttaccatttcatctcccctggaagcc
cacaaagcaaacactttagtgtatcatgtagttggagtagatgtcggatttgaaaatcca
atgtttgcttgtctggaaatggattatgaggaagcagacaatgatccaacaggggaagca
gcagctaatacccagcagacacttactttctatgagctagaccttggtttaaatcatgtg
gtccgaaaatacagtgaacctttggaggaacacggcaacttccttattacagttccagga
gggtcagatggtccaagtggagtactgatctgctctgaaaactatattacttacaagaac
tttggtgaccagccagatatccgctgtccaattcccaggaggcggaatgacctggatgac
cctgaaagaggaatgatttttgtctgctctgcaacccataaaaccaaatcgatgttcttc
tttttggctcaaactgagcagggagatatctttaagatcactttggagacagatgaagat
atggttactgagatccggctcaaatattttgatactgtacccgttgctgctgccatgtgt
gtgcttaaaacagggttcctttttgtagcatcagaatttggaaaccattacttatatcaa
attgcacatcttggagatgatgatgaagaacctgagttttcatcagccatgcctctggaa
gaaggagacacattcttttttcagccaagaccacttaaaaaccttgtgctggttgatgag
ttggacagcctctctcccattctgttttgccagatagctgatctggccaatgaagatact
ccacagttgtatgtggcctgtggtaggggaccccgatcatctctgagagtcctaagacat
ggacttgaggtgtcagaaatggctgtttctgagctacctggtaaccccaacgctgtctgg
acagtgcgtcgacacattgaagatgagtttgatgcctacatcattgtgtctttcgtgaat
gccaccctagtgttgtccattggagaaactgtagaagaagtgactgactctgggttcctg
gggaccaccccgaccttgtcctgctccttattaggagatgatgccttggtgcaggtctat
ccagatggcattcggcacatacgagcagacaagagagtcaatgagtggaagacccctgga
aagaaaacaattgtgaagtgtgcagtgaaccagcgacaagtggtgattgccctgacagga
ggagagctggtctatttcgagatggatccttcaggacagctgaatgagtacacagaacgg
aaggagatgtcagcagatgtggtgtgcatgagtctggccaatgtaccccctggagagcag
cggtctcgcttcctggctgtggggcttgtggacaacactgtcagaatcatctccctggat
ccctcagactgtttgcaacctctaagcatgcaggctctcccagcccagcctgagtccttg
tgtatcgtggaaatgggtgggactgagaagcaggatgagctgggtgagaggggctcgatt
ggcttcctatacctgaatattgggctacagaacggtgtgctgctgaggactgtcttggac
cctgtcactggggatttgtctgatactcgcactcggtacctggggtcccgtcctgtgaag
ctcttccgagtccgaatgcaaggccaggaggcagtattggccatgtcaagccgctcatgg
ttgagctattcttaccaatctcgcttccatctcaccccactgtcttacgagacactggaa
tttgcatcgggttttgcctcggaacagtgtcccgagggcattgtggccatctccaccaac
accctacggattttggcattagagaagctcggtgctgtcttcaatcaagtagccttccca
ctgcagtacacacccaggaaatttgtcatccaccctgagagtaacaaccttattatcatt
gaaacggaccacaatgcctacactgaggccacgaaagctcagagaaagcagcagatggca
gaggaaatggtggaagcagcaggggaggatgagcgggagctggccgcagagatggcagca
gcattcctcaatgaaaacctccctgaatccatctttggagctcccaaggctggcaatggg
cagtgggcctctgtgatccgagtgatgaatcccattcaagggaacacactggaccttgtc
cagctggaacagaatgaggcagcttttagtgtggctgtgtgcaggttttccaacactggt
gaagactggtatgtgctggtgggtgtggccaaggacctgatactaaacccccgatctgtg
gcagggggcttcgtctatacttacaagcttgtgaacaatggggaaaaactggagtttttg
cacaagactcctgtggaagaggtccctgctgctattgccccattccaggggagggtgttg
attggtgtggggaagctgttgcgtgtctatgacctgggaaagaagaagttactccgaaaa
tgtgagaataagcatattgccaattatatctctgggatccagactatcggacatagggta
attgtatctgatgtccaagaaagtttcatctgggttcgctacaagcgtaatgaaaaccag
cttatcatctttgctgatgatacctacccccgatgggtcactacagccagcctcctggac
tatgacactgtggctggggcagacaagtttggcaacatatgtgtggtgaggctcccacct
aacaccaatgatgaagtagatgaggatcctacaggaaacaaagccctgtgggaccgtggc
ttgctcaatggggcctcccagaaggcagaggtgatcatgaactaccatgtcggggagacg
gtgctgtccttgcagaagaccacgctgatccctggaggctcagaatcacttgtctatacc
accttgtctggaggaattggcatccttgtgccattcacgtcccatgaggaccatgacttc
ttccagcatgtggaaatgcacctgcggtctgaacatccccctctctgtgggcgggaccac
ctcagctttcgctcctactacttccctgtgaagaatgtgattgatggagacctctgtgag
cagttcaattccatggaacccaacaaacaaaagaacgtctctgaagaactggaccgaacc
ccacccgaagtgtccaagaaactcgaggatatccggacccgctacgccttctga

KEGG   Homo sapiens (human): 23451
Entry
23451             CDS       T01001                                 
Symbol
SF3B1, Hsh155, MDS, PRP10, PRPF10, SAP155, SF3b155
Name
(RefSeq) splicing factor 3b subunit 1
  KO
K12828  splicing factor 3B subunit 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
Disease
H01481  Myelodysplastic syndrome
H02410  Myelodysplastic/myeloproliferative neoplasms
H02411  Chronic myelomonocytic leukemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    23451 (SF3B1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    23451 (SF3B1)
   03036 Chromosome and associated proteins [BR:hsa03036]
    23451 (SF3B1)
Spliceosome [BR:hsa03041]
 Complex A
  U2 snRNP components
   U2 snRNP specific factors
    23451 (SF3B1)
 Complex B
    23451 (SF3B1)
 Complex C
   U2 SnRNP specific factors
    23451 (SF3B1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Chromatin remodeling factors
   B-WICH complex
    23451 (SF3B1)
SSDB
Motif
Pfam: SF3b1 HEAT_2 Adaptin_N UNC45-central IFRD
Other DBs
NCBI-GeneID: 23451
NCBI-ProteinID: NP_036565
OMIM: 605590
HGNC: 10768
Ensembl: ENSG00000115524
Pharos: O75533(Tbio)
UniProt: O75533 B4DGZ4
Structure
LinkDB
Position
2:complement(197389784..197435093)
AA seq 1304 aa
MAKIAKTHEDIEAQIREIQGKKAALDEAQGVGLDSTGYYDQEIYGGSDSRFAGYVTSIAA
TELEDDDDDYSSSTSLLGQKKPGYHAPVALLNDIPQSTEQYDPFAEHRPPKIADREDEYK
KHRRTMIISPERLDPFADGGKTPDPKMNARTYMDVMREQHLTKEEREIRQQLAEKAKAGE
LKVVNGAAASQPPSKRKRRWDQTADQTPGATPKKLSSWDQAETPGHTPSLRWDETPGRAK
GSETPGATPGSKIWDPTPSHTPAGAATPGRGDTPGHATPGHGGATSSARKNRWDETPKTE
RDTPGHGSGWAETPRTDRGGDSIGETPTPGASKRKSRWDETPASQMGGSTPVLTPGKTPI
GTPAMNMATPTPGHIMSMTPEQLQAWRWEREIDERNRPLSDEELDAMFPEGYKVLPPPAG
YVPIRTPARKLTATPTPLGGMTGFHMQTEDRTMKSVNDQPSGNLPFLKPDDIQYFDKLLV
DVDESTLSPEEQKERKIMKLLLKIKNGTPPMRKAALRQITDKAREFGAGPLFNQILPLLM
SPTLEDQERHLLVKVIDRILYKLDDLVRPYVHKILVVIEPLLIDEDYYARVEGREIISNL
AKAAGLATMISTMRPDIDNMDEYVRNTTARAFAVVASALGIPSLLPFLKAVCKSKKSWQA
RHTGIKIVQQIAILMGCAILPHLRSLVEIIEHGLVDEQQKVRTISALAIAALAEAATPYG
IESFDSVLKPLWKGIRQHRGKGLAAFLKAIGYLIPLMDAEYANYYTREVMLILIREFQSP
DEEMKKIVLKVVKQCCGTDGVEANYIKTEILPPFFKHFWQHRMALDRRNYRQLVDTTVEL
ANKVGAAEIISRIVDDLKDEAEQYRKMVMETIEKIMGNLGAADIDHKLEEQLIDGILYAF
QEQTTEDSVMLNGFGTVVNALGKRVKPYLPQICGTVLWRLNNKSAKVRQQAADLISRTAV
VMKTCQEEKLMGHLGVVLYEYLGEEYPEVLGSILGALKAIVNVIGMHKMTPPIKDLLPRL
TPILKNRHEKVQENCIDLVGRIADRGAEYVSAREWMRICFELLELLKAHKKAIRRATVNT
FGYIAKAIGPHDVLATLLNNLKVQERQNRVCTTVAIAIVAETCSPFTVLPALMNEYRVPE
LNVQNGVLKSLSFLFEYIGEMGKDYIYAVTPLLEDALMDRDLVHRQTASAVVQHMSLGVY
GFGCEDSLNHLLNYVWPNVFETSPHVIQAVMGALEGLRVAIGPCRMLQYCLQGLFHPARK
VRDVYWKIYNSIYIGSQDALIAHYPRIYNDDKNTYIRYELDYIL
NT seq 3915 nt   +upstreamnt  +downstreamnt
atggcgaagatcgccaagactcacgaagatattgaagcacagattcgagaaattcaaggc
aagaaggcagctcttgatgaagctcaaggagtgggcctcgattctacaggttattatgac
caggaaatttatggtggaagtgacagcagatttgctggatacgtgacatcaattgctgca
actgaacttgaagatgatgacgatgactattcatcatctacgagtttgcttggtcagaag
aagccaggatatcatgcccctgtggcattgcttaatgatataccacagtcaacagaacag
tatgatccatttgctgagcacagacctccaaagattgcagaccgggaagatgaatacaaa
aagcataggcggaccatgataatttccccagagcgtcttgatccttttgcagatggaggg
aaaacccctgatcctaaaatgaatgctaggacttacatggatgtaatgcgagaacaacac
ttgactaaagaagaacgagaaattaggcaacagctagcagaaaaagctaaagctggagaa
ctaaaagtcgtcaatggagcagcagcgtcccagcctccatcaaaacgaaaacggcgttgg
gatcaaacagctgatcagactcctggtgccactcccaaaaaactatcaagttgggatcag
gcagagacccctgggcatactccttccttaagatgggatgagacaccaggtcgtgcaaag
ggaagcgagactcctggagcaaccccaggctcaaaaatatgggatcctacacctagccac
acaccagcgggagctgctactcctggacgaggtgatacaccaggccatgcgacaccaggc
catggaggcgcaacttccagtgctcgtaaaaacagatgggatgaaacccccaaaacagag
agagatactcctgggcatggaagtggatgggctgagactcctcgaacagatcgaggtgga
gattctattggtgaaacaccgactcctggagccagtaaaagaaaatcacggtgggatgaa
acaccagctagtcagatgggtggaagcactccagttctgacccctggaaagacaccaatt
ggcacaccagccatgaacatggctacccctactccaggtcacataatgagtatgactcct
gaacagcttcaggcttggcggtgggaaagagaaattgatgagagaaatcgcccactttct
gatgaggaattagatgctatgttcccagaaggatataaggtacttcctcctccagctggt
tatgttcctattcgaactccagctcgaaagctgacagctactccaacacctttgggtggt
atgactggtttccacatgcaaactgaagatcgaactatgaaaagtgttaatgaccagcca
tctggaaatcttccatttttaaaacctgatgatattcaatactttgataaactattggtt
gatgttgatgaatcaacacttagtccagaagagcaaaaagagagaaaaataatgaagttg
cttttaaaaattaagaatggaacaccaccaatgagaaaggctgcattgcgtcagattact
gataaagctcgtgaatttggagctggtcctttgtttaatcagattcttcctctgctgatg
tctcctacacttgaggatcaagagcgtcatttacttgtgaaagttattgataggatactg
tacaaacttgatgacttagttcgtccatatgtgcataagatcctcgtggtcattgaaccg
ctattgattgatgaagattactatgctagagtggaaggccgagagatcatttctaatttg
gcaaaggctgctggtctggctactatgatctctaccatgagacctgatatagataacatg
gatgagtatgtccgtaacacaacagctagagcttttgctgttgtagcctctgccctgggc
attccttctttattgcccttcttaaaagctgtgtgcaaaagcaagaagtcctggcaagcg
agacacactggtattaagattgtacaacagatagctattcttatgggctgtgccatcttg
ccacatcttagaagtttagttgaaatcattgaacatggtcttgtggatgagcagcagaaa
gttcggaccatcagtgctttggccattgctgccttggctgaagcagcaactccttatggt
atcgaatcttttgattctgtgttaaagcctttatggaagggtatccgccaacacagagga
aagggtttggctgctttcttgaaggctattgggtatcttattcctcttatggatgcagaa
tatgccaactactatactagagaagtgatgttaatccttattcgagaattccagtctcct
gatgaggaaatgaaaaaaattgtgctgaaggtggtaaaacagtgttgtgggacagatggt
gtagaagcaaactacattaaaacagagattcttcctcccttttttaaacacttctggcag
cacaggatggctttggatagaagaaattaccgacagttagttgatactactgtggagttg
gcaaacaaagtaggtgcagcagaaattatatccaggattgtggatgatctgaaagatgaa
gccgaacagtacagaaaaatggtgatggagacaattgagaaaattatgggtaatttggga
gcagcagatattgatcataaacttgaagaacaactgattgatggtattctttatgctttc
caagaacagactacagaggactcagtaatgttgaacggctttggcacagtggttaatgct
cttggcaaacgagtcaaaccatacttgcctcagatctgtggtacagttttgtggcgttta
aataacaaatctgctaaagttaggcaacaggcagctgacttgatttctcgaactgctgtt
gtcatgaagacttgtcaagaggaaaaattgatgggacacttgggtgttgtattgtatgag
tatttgggtgaagagtaccctgaagtattgggcagcattcttggagcactgaaggccatt
gtaaatgtcataggtatgcataagatgactccaccaattaaagatctgctgcctagactc
acccccatcttaaagaacagacatgaaaaagtacaagagaattgtattgatcttgttggt
cgtattgctgacaggggagctgaatatgtatctgcaagagagtggatgaggatttgcttt
gagcttttagagctcttaaaagcccacaaaaaggctattcgtagagccacagtcaacaca
tttggttatattgcaaaggccattggccctcatgatgtattggctacacttctgaacaac
ctcaaagttcaagaaaggcagaacagagtttgtaccactgtagcaatagctattgttgca
gaaacatgttcaccctttacagtactccctgccttaatgaatgaatacagagttcctgaa
ctgaatgttcaaaatggagtgttaaaatcgctttccttcttgtttgaatatattggtgaa
atgggaaaagactacatttatgccgtaacaccgttacttgaagatgctttaatggataga
gaccttgtacacagacagacggctagtgcagtggtacagcacatgtcacttggggtttat
ggatttggttgtgaagattcgctgaatcacttgttgaactatgtatggcccaatgtattt
gagacatctcctcatgtaattcaggcagttatgggagccctagagggcctgagagttgct
attggaccatgtagaatgttgcaatattgtttacagggtctgtttcacccagcccggaaa
gtcagagatgtatattggaaaatttacaactccatctacattggttcccaggacgctctc
atagcacattacccaagaatctacaacgatgataagaacacctatattcgttatgaactt
gactatatcttataa

KEGG   Homo sapiens (human): 51639
Entry
51639             CDS       T01001                                 
Symbol
SF3B6, CGI-110, HSPC175, Ht006, P14, SAP14, SAP14a, SF3B14, SF3B14a
Name
(RefSeq) splicing factor 3b subunit 6
  KO
K12833  pre-mRNA branch site protein p14
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    51639 (SF3B6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    51639 (SF3B6)
Spliceosome [BR:hsa03041]
 Complex A
  U2 snRNP components
   U2 snRNP specific factors
    51639 (SF3B6)
 Complex B
    51639 (SF3B6)
 Complex C
   U2 SnRNP specific factors
    51639 (SF3B6)
SSDB
Motif
Pfam: RRM_1 RRM_5 RRM_7
Other DBs
NCBI-GeneID: 51639
NCBI-ProteinID: NP_057131
OMIM: 607835
HGNC: 30096
Ensembl: ENSG00000115128
Pharos: Q9Y3B4(Tdark)
UniProt: Q9Y3B4
Structure
LinkDB
Position
2:complement(24067586..24076326)
AA seq 125 aa
MAMQAAKRANIRLPPEVNRILYIRNLPYKITAEEMYDIFGKYGPIRQIRVGNTPETRGTA
YVVYEDIFDAKNACDHLSGFNVCNRYLVVLYYNANRAFQKMDTKKKEEQLKLLKEKYGIN
TDPPK
NT seq 378 nt   +upstreamnt  +downstreamnt
atggcgatgcaagcggccaagagggcgaacattcgacttccacctgaagtaaatcggata
ttgtatataagaaatttgccatacaaaatcacagctgaagaaatgtatgatatatttggg
aaatatggacctattcgtcaaatcagagtggggaacacacctgaaactagaggaacagct
tatgtggtctatgaggacatctttgatgccaagaatgcatgtgatcacctatcgggattc
aatgtttgtaacagataccttgtggttttgtactataatgccaacagggcatttcagaag
atggacacaaagaagaaggaggaacagttgaagcttctcaaggagaaatatggcatcaac
acagatccaccaaaataa

KEGG   Homo sapiens (human): 83443
Entry
83443             CDS       T01001                                 
Symbol
SF3B5, SF3b10, Ysf3
Name
(RefSeq) splicing factor 3b subunit 5
  KO
K12832  splicing factor 3B subunit 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    83443 (SF3B5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    83443 (SF3B5)
Spliceosome [BR:hsa03041]
 Complex A
  U2 snRNP components
   U2 snRNP specific factors
    83443 (SF3B5)
 Complex B
    83443 (SF3B5)
 Complex C
   U2 SnRNP specific factors
    83443 (SF3B5)
SSDB
Motif
Pfam: SF3b10 DUF2264
Other DBs
NCBI-GeneID: 83443
NCBI-ProteinID: NP_112577
OMIM: 617847
HGNC: 21083
Ensembl: ENSG00000169976
Pharos: Q9BWJ5(Tdark)
UniProt: Q9BWJ5
Structure
LinkDB
Position
6:complement(144094884..144095573)
AA seq 86 aa
MTDRYTIHSQLEHLQSKYIGTGHADTTKWEWLVNQHRDSYCSYMGHFDLLNYFAIAENES
KARVRFNLMEKMLQPCGPPADKPEEN
NT seq 261 nt   +upstreamnt  +downstreamnt
atgactgaccgctacaccatccatagccagctggagcacctgcagtccaagtacatcggc
acgggccacgccgacaccaccaagtgggagtggctggtgaaccaacaccgcgactcgtac
tgctcctacatgggccacttcgaccttctcaactacttcgccattgcggagaatgagagc
aaagcgcgagtccgcttcaacttgatggaaaagatgcttcagccttgtggaccgccagcc
gacaagcccgaggagaactga

KEGG   Homo sapiens (human): 84844
Entry
84844             CDS       T01001                                 
Symbol
PHF5A, INI, Rds3, SAP14b, SF3B7, SF3b14b, bK223H9.2
Name
(RefSeq) PHD finger protein 5A
  KO
K12834  PHD finger-like domain-containing protein 5A
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    84844 (PHF5A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    84844 (PHF5A)
Spliceosome [BR:hsa03041]
 Complex A
  U2 snRNP components
   U2 snRNP specific factors
    84844 (PHF5A)
 Complex B
    84844 (PHF5A)
 Complex C
   U2 SnRNP specific factors
    84844 (PHF5A)
SSDB
Motif
Pfam: PHF5 PolC_DP2
Other DBs
NCBI-GeneID: 84844
NCBI-ProteinID: NP_116147
OMIM: 617846
HGNC: 18000
Ensembl: ENSG00000100410
Pharos: Q7RTV0(Tbio)
UniProt: Q7RTV0 A0A024R1U2
Structure
LinkDB
Position
22:complement(41459717..41468692)
AA seq 110 aa
MAKHHPDLIFCRKQAGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVI
CGGPGVSDAYYCKECTIQEKDRDGCPKIVNLGSSKTDLFYERKKYGFKKR
NT seq 333 nt   +upstreamnt  +downstreamnt
atggctaaacatcatcctgatttgatcttttgccgcaagcaggctggtgttgccatcgga
agactgtgtgaaaaatgtgatggcaagtgtgtgatttgtgactcctatgtgcgtccctgc
actctggtgcgcatatgtgatgagtgtaactatggatcttaccaggggcgctgtgtgatc
tgtggaggacctggggtctctgatgcctattattgtaaggagtgcaccatccaggagaag
gacagagatggctgcccaaagattgtcaatctggggagctctaagacagacctcttctat
gaacgcaaaaaatacggcttcaagaagaggtga

DBGET integrated database retrieval system