KEGG   Homo sapiens (human): 102724334
Entry
102724334         CDS       T01001                                 
Name
(RefSeq) histone H2B type F-S-like
  KO
K11252  histone H2B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04613  Neutrophil extracellular trap formation
hsa05034  Alcoholism
hsa05203  Viral carcinogenesis
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    102724334
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    102724334
  09163 Immune disease
   05322 Systemic lupus erythematosus
    102724334
  09165 Substance dependence
   05034 Alcoholism
    102724334
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    102724334
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    102724334
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    102724334
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102724334
SSDB
Motif
Pfam: Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa DUF6246
Other DBs
NCBI-GeneID: 102724334
NCBI-ProteinID: XP_006723981
Ensembl: ENSG00000274559
UniProt: P57053
LinkDB
Position
21:complement(5972947..5973385)
AA seq 126 aa
MPEPAKSAPAPKKGSKKAVTKAQKKDGRKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLPHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSAK
NT seq 381 nt   +upstreamnt  +downstreamnt
atgccggagccagcgaagtccgctcccgcgcccaagaagggctcgaagaaagccgtgact
aaggcgcagaagaaggacggcaggaagcgcaagcgcagccgcaaggagagctactccgta
tacgtgtacaaggtgctgaagcaggtccaccccgacaccggcatctcctctaaggccatg
ggaatcatgaactccttcgtcaacgacatcttcgaacgcatcgcaggtgaggcttcccgc
ctgccgcattacaacaagcgctcgaccatcacctccagggagatccagacggccgtgcgc
ctgctgctgcccggggagttggccaagcacgccgtgtccgagggcaccaaggccgtcacc
aagtacaccagcgctaagtaa

KEGG   Homo sapiens (human): 114483833
Entry
114483833         CDS       T01001                                 
Symbol
H2BK1, H2BE1
Name
(RefSeq) H2B.K variant histone 1
  KO
K11252  histone H2B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04613  Neutrophil extracellular trap formation
hsa05034  Alcoholism
hsa05203  Viral carcinogenesis
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    114483833 (H2BK1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    114483833 (H2BK1)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    114483833 (H2BK1)
  09165 Substance dependence
   05034 Alcoholism
    114483833 (H2BK1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    114483833 (H2BK1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    114483833 (H2BK1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    114483833 (H2BK1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   114483833 (H2BK1)
SSDB
Motif
Pfam: Histone CBFD_NFYB_HMF CENP-T_C
Other DBs
NCBI-GeneID: 114483833
NCBI-ProteinID: NP_001356054
HGNC: 53833
Ensembl: ENSG00000285480
LinkDB
Position
7:complement(151207837..151210488)
AA seq 122 aa
MSAEYGQRQQPGGRGGRSSGNKKSKKRCRRKESYSMYIYKVLKQVHPDIGISAKAMSIMN
SFVNDVFEQLACEAARLAQYSGRTTLTSREVQTAVRLLLPGELAKHAVSEGTKAVTKYTS
SK
NT seq 369 nt   +upstreamnt  +downstreamnt
atgagcgctgagtatggacagcggcagcagcccgggggccgtgggggtcgcagttctggg
aacaaaaagtccaaaaagcgctgtcggcgcaaggagtcctactccatgtatatctacaag
gtgctgaagcaggtgcaccctgacattggcatctctgccaaggccatgagcatcatgaac
tcgtttgtaaacgacgtgtttgagcagctggcgtgtgaggctgcccggctggcccagtac
tcgggccggaccaccctgacatcccgagaagtccagacggctgtgcgtctgctgctgcct
ggggagctggccaagcacgctgtgtctgagggcaccaaggctgtcaccaagtacaccagc
tccaagtga

KEGG   Homo sapiens (human): 128312
Entry
128312            CDS       T01001                                 
Symbol
H2BC26, H2BU1, H2Bb, HIST3H2BB
Name
(RefSeq) H2B clustered histone 26
  KO
K11252  histone H2B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04613  Neutrophil extracellular trap formation
hsa05034  Alcoholism
hsa05203  Viral carcinogenesis
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    128312 (H2BC26)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    128312 (H2BC26)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    128312 (H2BC26)
  09165 Substance dependence
   05034 Alcoholism
    128312 (H2BC26)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    128312 (H2BC26)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    128312 (H2BC26)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    128312 (H2BC26)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   128312 (H2BC26)
SSDB
Motif
Pfam: Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa CENP-T_C
Other DBs
NCBI-GeneID: 128312
NCBI-ProteinID: NP_778225
OMIM: 615046
HGNC: 20514
Ensembl: ENSG00000196890
Pharos: Q8N257(Tbio)
UniProt: Q8N257
Structure
LinkDB
Position
1:228458103..228458558
AA seq 126 aa
MPDPSKSAPAPKKGSKKAVTKAQKKDGKKRKRGRKESYSIYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIASEASRLAHYNKRSTITSREVQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
NT seq 381 nt   +upstreamnt  +downstreamnt
atgccagacccgtccaaatcggctcctgcgcccaagaagggttctaaaaaggctgtcacc
aaggcacagaagaaggacggcaagaagcgcaagcgcggccgcaaggagagctattctatc
tacgtgtacaaggtgctgaagcaggtgcaccccgacaccggcatctcgtccaaggccatg
ggcatcatgaactccttcgtcaatgacatcttcgagcgcatcgccagcgaggcctcccgc
ctggcacactacaacaagcgctccaccatcacgtcccgcgaagtgcagacggccgttcgc
ctgctgctgcccggcgagctggccaagcacgccgtgtccgagggcaccaaggctgtcacc
aagtacaccagctccaagtga

KEGG   Homo sapiens (human): 158983
Entry
158983            CDS       T01001                                 
Symbol
H2BW1, H2BFWT, TH2B-175
Name
(RefSeq) H2B.W histone 1
  KO
K11252  histone H2B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04613  Neutrophil extracellular trap formation
hsa05034  Alcoholism
hsa05203  Viral carcinogenesis
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    158983 (H2BW1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    158983 (H2BW1)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    158983 (H2BW1)
  09165 Substance dependence
   05034 Alcoholism
    158983 (H2BW1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    158983 (H2BW1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    158983 (H2BW1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    158983 (H2BW1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   158983 (H2BW1)
SSDB
Motif
Pfam: Histone CBFD_NFYB_HMF TAF
Other DBs
NCBI-GeneID: 158983
NCBI-ProteinID: NP_001002916
OMIM: 300507
HGNC: 27252
Ensembl: ENSG00000123569
Pharos: Q7Z2G1(Tdark)
UniProt: Q7Z2G1
LinkDB
Position
X:complement(104011147..104013708)
AA seq 147 aa
MAGPSSETTSEEQLITQEPKEANSTTSQKQSKQRKRGRHGPRRCHSNCRGDSFATYFRRV
LKQVHQGLSLSREAVSVMDSLVHDILDRIATEAGHLARSTKRQTITAWETRMAVRLLLPG
QMGKLAESEGTKAVLRTSLYAIQQQRK
NT seq 444 nt   +upstreamnt  +downstreamnt
atggctggaccttcctctgagacgacctctgaggaacagctgatcacccaggagcccaaa
gaggccaactccactacgtcccagaagcagagcaagcagaggaagcgagggcgccatggg
ccccgcaggtgccactccaactgccgcggggacagcttcgccacctatttccgccgggtg
ctgaagcaggttcaccagggcctcagcctttcccgggaggccgtgagtgtcatggattct
ttggttcatgacatattggaccgcatcgccaccgaggctggtcacctggcccgctccacc
aagcgccagaccatcactgcctgggagacccggatggctgtgcgcctgctgctgccgggg
cagatgggcaagctcgccgagtccgaaggcacgaaggctgtcctcagaacttcactgtat
gccatacagcaacagagaaagtga

KEGG   Homo sapiens (human): 255626
Entry
255626            CDS       T01001                                 
Symbol
H2BC1, H2BFU, HIST1H2BA, STBP, TH2B, TSH2B, TSH2B.1, bA317E16.3, hTSH2B
Name
(RefSeq) H2B clustered histone 1
  KO
K11252  histone H2B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04613  Neutrophil extracellular trap formation
hsa05034  Alcoholism
hsa05203  Viral carcinogenesis
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    255626 (H2BC1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    255626 (H2BC1)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    255626 (H2BC1)
  09165 Substance dependence
   05034 Alcoholism
    255626 (H2BC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    255626 (H2BC1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    255626 (H2BC1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    255626 (H2BC1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   255626 (H2BC1)
SSDB
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like
Other DBs
NCBI-GeneID: 255626
NCBI-ProteinID: NP_733759
OMIM: 609904
HGNC: 18730
Ensembl: ENSG00000146047
Pharos: Q96A08(Tbio)
UniProt: Q96A08
Structure
LinkDB
Position
6:25726777..25727345
AA seq 127 aa
MPEVSSKGATISKKGFKKAVVKTQKKEGKKRKRTRKESYSIYIYKVLKQVHPDTGISSKA
MSIMNSFVTDIFERIASEASRLAHYSKRSTISSREIQTAVRLLLPGELAKHAVSEGTKAV
TKYTSSK
NT seq 384 nt   +upstreamnt  +downstreamnt
atgccggaggtgtcatctaaaggtgctaccatttccaagaagggctttaagaaagctgtc
gttaagacccagaaaaaggaaggcaaaaagcgcaagaggacccgtaaggagagttattct
atttacatctacaaagtgctaaagcaggtccatccggacactggcatctcttcgaaagct
atgagcattatgaattccttcgtcactgatatctttgagcgtatagcgagcgaggcatca
cgtttggctcactacagcaagcgctccaccatttcttccagagagattcagacagcagtg
cgcttgctactgccgggagagctggctaaacatgctgtgtctgagggcaccaaggctgtc
actaagtacaccagctccaagtaa

KEGG   Homo sapiens (human): 286436
Entry
286436            CDS       T01001                                 
Symbol
H2BW2, H2BFM, H2BM
Name
(RefSeq) H2B.W histone 2
  KO
K11252  histone H2B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04613  Neutrophil extracellular trap formation
hsa05034  Alcoholism
hsa05203  Viral carcinogenesis
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    286436 (H2BW2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    286436 (H2BW2)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    286436 (H2BW2)
  09165 Substance dependence
   05034 Alcoholism
    286436 (H2BW2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    286436 (H2BW2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    286436 (H2BW2)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    286436 (H2BW2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   286436 (H2BW2)
SSDB
Motif
Pfam: Histone CBFD_NFYB_HMF TAF TFIID_20kDa CENP-S TFIID-18kDa Jiv90
Other DBs
NCBI-GeneID: 286436
NCBI-ProteinID: NP_001157888
HGNC: 27867
Ensembl: ENSG00000101812
Pharos: P0C1H6(Tdark)
UniProt: P0C1H6 W0TYI6
LinkDB
Position
X:104039956..104042454
AA seq 148 aa
MAEASSETTSEEGQSIQEPKEANSTKAQKQKRRGCRGSRRRHANRRGDSFGDSFTPYFPR
VLKQVHQGLSLSQEAVSVMDSMIHDILDRIATEAGQLAHYTKRVTITSRDIQMAVRLLLP
GKMGKLAEAQGTNAALRTSLCAIWQQRK
NT seq 447 nt   +upstreamnt  +downstreamnt
atggctgaggcttcctctgagacaacctcggaggaaggccagagcatccaggagcccaaa
gaggccaactccacgaaggcccagaagcagaagaggcgagggtgccgaggctcccgcagg
cgccacgccaaccgccgtggggacagcttcggggacagcttcaccccctatttcccccgg
gtgctgaagcaggttcaccagggcctcagcctttcccaggaggccgtgagtgtcatggat
tctatgatccatgacatattggaccgcatcgccaccgaggctggtcagctggcccattac
accaagcgcgtgaccatcacctcccgggacatccagatggccgtgcgactgctgctgccg
gggaagatgggcaagctcgccgaggcccagggcacgaatgccgccctcagaacttcatta
tgtgcgatatggcaacagagaaagtga

KEGG   Homo sapiens (human): 3017
Entry
3017              CDS       T01001                                 
Symbol
H2BC5, H2B.1B, H2B/a, H2B/b, H2B/g, H2B/h, H2B/k, H2B/l, H2BFA, H2BFB, H2BFG, H2BFH, H2BFK, H2BFL, HIRIP2, HIST1H2BC, HIST1H2BD, HIST1H2BE, HIST1H2BF, HIST1H2BG, HIST1H2BI, dJ221C16.6
Name
(RefSeq) H2B clustered histone 5
  KO
K11252  histone H2B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04613  Neutrophil extracellular trap formation
hsa05034  Alcoholism
hsa05203  Viral carcinogenesis
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    3017 (H2BC5)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    3017 (H2BC5)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    3017 (H2BC5)
  09165 Substance dependence
   05034 Alcoholism
    3017 (H2BC5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    3017 (H2BC5)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3017 (H2BC5)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    3017 (H2BC5)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3017 (H2BC5)
SSDB
Motif
Pfam: Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa
Other DBs
NCBI-GeneID: 3017
NCBI-ProteinID: NP_066407
OMIM: 602799
HGNC: 4747
Ensembl: ENSG00000158373
Pharos: P58876(Tbio)
UniProt: P62807 P58876 A0A024QZZ7
Structure
LinkDB
Position
6:26158121..26171349
AA seq 126 aa
MPEPTKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
NT seq 381 nt   +upstreamnt  +downstreamnt
atgcctgaacctaccaagtctgctcctgccccaaagaagggctccaagaaggcggtgact
aaggctcagaagaaggacgggaagaagcgcaagcgcagccgcaaggagagctattcagtg
tatgtgtacaaggtgctgaagcaggtccatcccgacaccggcatctcttccaaggcaatg
gggatcatgaattccttcgtcaacgacatcttcgagcgcatcgcaggcgaggcttcccgc
ctggcgcattacaacaagcgctcgaccatcacctccagggagatccagacggccgtgcgc
ctgctgcttccgggggagctggccaagcacgccgtgtcggagggcaccaaggccgtcacc
aagtacaccagttccaagtaa

KEGG   Homo sapiens (human): 3018
Entry
3018              CDS       T01001                                 
Symbol
H2BC3, H2B.1, H2B/f, H2BFF, HIST1H2BB
Name
(RefSeq) H2B clustered histone 3
  KO
K11252  histone H2B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04613  Neutrophil extracellular trap formation
hsa05034  Alcoholism
hsa05203  Viral carcinogenesis
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    3018 (H2BC3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    3018 (H2BC3)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    3018 (H2BC3)
  09165 Substance dependence
   05034 Alcoholism
    3018 (H2BC3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    3018 (H2BC3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3018 (H2BC3)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    3018 (H2BC3)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3018 (H2BC3)
SSDB
Motif
Pfam: Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa
Other DBs
NCBI-GeneID: 3018
NCBI-ProteinID: NP_066406
OMIM: 602803
HGNC: 4751
Ensembl: ENSG00000276410
Pharos: P33778(Tdark)
UniProt: P33778
Structure
LinkDB
Position
6:complement(26043227..26043713)
AA seq 126 aa
MPEPSKSAPAPKKGSKKAITKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
NT seq 381 nt   +upstreamnt  +downstreamnt
atgcctgaaccctctaagtctgctccagcccctaaaaagggttctaagaaggctatcact
aaggcgcagaagaaggatggtaagaagcgtaagcgcagccgcaaggagagctattctatc
tatgtgtacaaggttctgaagcaggtccaccccgacaccggcatctcatccaaggccatg
gggatcatgaattccttcgtcaacgacatcttcgagcgcatcgcgggcgaggcttctcgc
ctggctcactacaataagcgctcgaccatcacctccagggagattcagacggctgtgcgc
ctgctgctgcctggggagctggctaagcatgctgtgtccgagggcactaaggcagttacc
aagtacactagctctaaataa

KEGG   Homo sapiens (human): 440689
Entry
440689            CDS       T01001                                 
Symbol
H2BC18, HIST2H2BF
Name
(RefSeq) H2B clustered histone 18
  KO
K11252  histone H2B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04613  Neutrophil extracellular trap formation
hsa05034  Alcoholism
hsa05203  Viral carcinogenesis
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    440689 (H2BC18)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    440689 (H2BC18)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    440689 (H2BC18)
  09165 Substance dependence
   05034 Alcoholism
    440689 (H2BC18)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    440689 (H2BC18)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    440689 (H2BC18)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    440689 (H2BC18)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   440689 (H2BC18)
SSDB
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like DUF6246 CENP-T_C
Other DBs
NCBI-GeneID: 440689
NCBI-ProteinID: NP_001019770
HGNC: 24700
Ensembl: ENSG00000203814
Pharos: Q5QNW6(Tdark)
UniProt: Q5QNW6
Structure
LinkDB
Position
1:complement(149782689..149812370)
AA seq 126 aa
MPDPAKSAPAPKKGSKKAVTKVQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
NT seq 381 nt   +upstreamnt  +downstreamnt
atgccggatccagcgaaatccgctcctgctcccaagaagggctccaaaaaggctgttacg
aaagtgcagaagaaggacggcaagaagcgcaagcgcagccgcaaggagagctactccgtt
tacgtgtacaaggtgctgaagcaggtccaccccgacaccggcatctcgtccaaggccatg
ggcatcatgaactccttcgtcaacgacatcttcgagcgcatcgcgggagaggcgtcccgc
ctggcgcactacaacaagcgctccaccatcacatcccgcgagatccagacggccgtgcgc
ctgctgctgcccggcgagctggccaagcacgccgtgtccgagggcaccaaggcggtcacc
aagtacaccagctcgaagtaa

KEGG   Homo sapiens (human): 54145
Entry
54145             CDS       T01001                                 
Symbol
H2BC12L, H2B/s, H2BFS, H2BS1
Name
(RefSeq) H2B clustered histone 12 like
  KO
K11252  histone H2B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04613  Neutrophil extracellular trap formation
hsa05034  Alcoholism
hsa05203  Viral carcinogenesis
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    54145 (H2BC12L)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    54145 (H2BC12L)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    54145 (H2BC12L)
  09165 Substance dependence
   05034 Alcoholism
    54145 (H2BC12L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    54145 (H2BC12L)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    54145 (H2BC12L)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    54145 (H2BC12L)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   54145 (H2BC12L)
SSDB
Motif
Pfam: Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa DUF6246
Other DBs
NCBI-GeneID: 54145
NCBI-ProteinID: NP_059141
HGNC: 4762
Ensembl: ENSG00000234289
LinkDB
Position
21:43565182..43565648
AA seq 126 aa
MPEPAKSAPAPKKGSKKAVTKAQKKDGRKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLPHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSAK
NT seq 381 nt   +upstreamnt  +downstreamnt
atgccggagccagcgaagtccgctcccgcgcccaagaagggctcgaagaaagccgtgact
aaggcgcagaagaaggacggcaggaagcgcaagcgcagccgcaaggagagctactccgta
tacgtgtacaaggtgctgaagcaggtccaccccgacaccggcatctcctctaaggccatg
ggaatcatgaactccttcgtcaacgacatcttcgaacgcatcgcaggtgaggcttcccgc
ctgccgcattacaacaagcgctcgaccatcacctccagggagatccagacggccgtgcgc
ctgctgctgcccggggagttggccaagcacgccgtgtccgagggcaccaaggccgtcacc
aagtacaccagcgctaagtaa

DBGET integrated database retrieval system