KEGG   Homo sapiens (human): 102725035
Entry
102725035         CDS       T01001                                 
Name
(RefSeq) leukocyte immunoglobulin-like receptor subfamily B member 3
  KO
K06512  leukocyte immunoglobulin-like receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04380  Osteoclast differentiation
hsa04662  B cell receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04662 B cell receptor signaling pathway
    102725035
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102725035
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    102725035
CD molecules [BR:hsa04090]
 Proteins
  102725035
SSDB
Motif
Pfam: Ig_2 Ig_3 ig RCSD
Other DBs
NCBI-GeneID: 102725035
NCBI-ProteinID: XP_006726377
UniProt: O75022
LinkDB
Position
19
AA seq 631 aa
MTPALTALLCLGLSLGPRTRVQAGPFPKPTLWAEPGSVISWGSPVTIWCQGSLEAQEYRL
DKEGSPEPLDRNNPLEPKNKARFSIPSMTEHHAGRYRCHYYSSAGWSEPSDPLELVMTGF
YNKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSGGFQAL
FPVGPVNPSHRWRFTCYYYYMNTPQVWSHPSDPLEILPSGVSRKPSLLTLQGPVLAPGQS
LTLQCGSDVGYDRFVLYKEGERDFLQRPGQQPQAGLSQANFTLGPVSPSHGGQYRCYGAH
NLSSEWSAPSDPLNILMAGQIYDTVSLSAQPGPTVASGENVTLLCQSWWQFDTFLLTKEG
AAHPPLRLRSMYGAHKYQAEFPMSPVTSAHAGTYRCYGSYSSNPHLLSFPSEPLELMVSG
HSGGSSLPPTGPPSTPGLGRYLEVLIGVSVAFVLLLFLLLFLLLRRQRHSKHRTSDQRKT
DFQRPAGAAETEPKDRGLLRRSSPAADVQEENLYAAVKDTQSEDRVELDSQSPHDEDPQA
VTYAPVKHSSPRREMASPPSSLSGEFLDTKDRQVEEDRQMDTEAAASEASQDVTYAQLHS
LTLRRKATEPPPSQEGEPPAEPSIYATLAIH
NT seq 1896 nt   +upstreamnt  +downstreamnt
atgacgcccgccctcacagccctgctctgccttgggctgagtctgggccccaggacccgc
gtgcaggcagggcccttccccaaacccaccctctgggctgagccaggctctgtgatcagc
tgggggagccccgtgaccatctggtgtcaggggagcctggaggcccaggagtaccgactg
gataaagagggaagcccagagcccttggacagaaataacccactggaacccaagaacaag
gccagattctccatcccatccatgacagagcaccatgcggggagataccgctgccactat
tacagctctgcaggctggtcagagcccagcgaccccctggagctggtgatgacaggattc
tacaacaaacccaccctctcagccctgcccagccctgtggtggcctcaggggggaatatg
accctccgatgtggctcacagaagggatatcaccattttgttctgatgaaggaaggagaa
caccagctcccccggaccctggactcacagcagctccacagtggggggttccaggccctg
ttccctgtgggccccgtgaaccccagccacaggtggaggttcacatgctattactattat
atgaacaccccccaggtgtggtcccaccccagtgaccccctggagattctgccctcaggc
gtgtctaggaagccctccctcctgaccctgcagggccctgtcctggcccctgggcagagc
ctgaccctccagtgtggctctgatgtcggctacgacagatttgttctgtataaggagggg
gaacgtgacttcctccagcgccctggccagcagccccaggctgggctctcccaggccaac
ttcaccctgggccctgtgagcccctcccacgggggccagtacaggtgctatggtgcacac
aacctctcctccgagtggtcggcccccagcgaccccctgaacatcctgatggcaggacag
atctatgacaccgtctccctgtcagcacagccgggccccacagtggcctcaggagagaac
gtgaccctgctgtgtcagtcatggtggcagtttgacactttccttctgaccaaagaaggg
gcagcccatcccccactgcgtctgagatcaatgtacggagctcataagtaccaggctgaa
ttccccatgagtcctgtgacctcagcccacgcggggacctacaggtgctacggctcatac
agctccaacccccacctgctgtctttccccagtgagcccctggaactcatggtctcagga
cactctggaggctccagcctcccacccacagggccgccctccacacctggtctgggaaga
tacctggaggttttgattggggtctcggtggccttcgtcctgctgctcttcctcctcctc
ttcctcctcctccgacgtcagcgtcacagcaaacacaggacatctgaccagagaaagact
gatttccagcgtcctgcaggggctgcggagacagagcccaaggacaggggcctgctgagg
aggtccagcccagctgctgacgtccaggaagaaaacctctatgctgccgtgaaggacaca
cagtctgaggacagggtggagctggacagtcagagcccacacgatgaagacccccaggca
gtgacgtatgccccggtgaaacactccagtcctaggagagaaatggcctctcctccctcc
tcactgtctggggaattcctggacacaaaggacagacaggtggaagaggacaggcagatg
gacactgaggctgctgcatctgaagcctcccaggatgtgacctacgcccagctgcacagc
ttgacccttagacggaaggcaactgagcctcctccatcccaggaaggggaacctccagct
gagcccagcatctacgccactctggccatccactag

KEGG   Homo sapiens (human): 10288
Entry
10288             CDS       T01001                                 
Symbol
LILRB2, CD85D, ILT-4, ILT4, LIR-2, LIR2, MIR-10, MIR10
Name
(RefSeq) leukocyte immunoglobulin like receptor B2
  KO
K06512  leukocyte immunoglobulin-like receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04380  Osteoclast differentiation
hsa04662  B cell receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04662 B cell receptor signaling pathway
    10288 (LILRB2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    10288 (LILRB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    10288 (LILRB2)
CD molecules [BR:hsa04090]
 Proteins
  10288 (LILRB2)
SSDB
Motif
Pfam: Ig_2 Ig_3 ig SIT RIFIN Orf78 Amnionless HemY_N TMEM156
Other DBs
NCBI-GeneID: 10288
NCBI-ProteinID: NP_001074447
OMIM: 604815
HGNC: 6606
Ensembl: ENSG00000131042
UniProt: Q8N423
Structure
LinkDB
Position
19:complement(54273812..54281110)
AA seq 597 aa
MTPIVTVLICLGLSLGPRTRVQTGTIPKPTLWAEPDSVITQGSPVTLSCQGSLEAQEYRL
YREKKSASWITRIRPELVKNGQFHIPSITWEHTGRYGCQYYSRARWSELSDPLVLVMTGA
YPKPTLSAQPSPVVTSGGRVTLQCESQVAFGGFILCKEGEDEHPQCLNSQPHARGSSRAI
FSVGPVSPNRRWSHRCYGYDLNSPYVWSSPSDLLELLVPGVSKKPSLSVQPGPVMAPGES
LTLQCVSDVGYDRFVLYKEGERDLRQLPGRQPQAGLSQANFTLGPVSRSYGGQYRCYGAH
NLSSECSAPSDPLDILITGQIRGTPFISVQPGPTVASGENVTLLCQSWRQFHTFLLTKAG
AADAPLRLRSIHEYPKYQAEFPMSPVTSAHAGTYRCYGSLNSDPYLLSHPSEPLELVVSG
PSMGSSPPPTGPISTPGPEDQPLTPTGSDPQSGLGRHLGVVIGILVAVVLLLLLLLLLFL
ILRHRRQGKHWTSTQRKADFQHPAGAVGPEPTDRGLQWRSSPAADAQEENLYAAVKDTQP
EDGVEMDTRAAASEAPQDVTYAQLHSLTLRRKATEPPPSQEREPPAEPSIYATLAIH
NT seq 1794 nt   +upstreamnt  +downstreamnt
atgacccccatcgtcacagtcctgatctgtctcgggctgagtctgggccccaggacccgc
gtgcagacagggaccatccccaagcccaccctgtgggctgagccagactctgtgatcacc
caggggagtcccgtcaccctcagttgtcaggggagccttgaagcccaggagtaccgtcta
tatagggagaaaaaatcagcatcttggattacacggatacgaccagagcttgtgaagaac
ggccagttccacatcccatccatcacctgggaacacacagggcgatatggctgtcagtat
tacagccgcgctcggtggtctgagctcagtgaccccctggtgctggtgatgacaggagcc
tacccaaaacccaccctctcagcccagcccagccctgtggtgacctcaggaggaagggtg
accctccagtgtgagtcacaggtggcatttggcggcttcattctgtgtaaggaaggagaa
gatgaacacccacaatgcctgaactcccagccccatgcccgtgggtcgtcccgcgccatc
ttctccgtgggccccgtgagcccgaatcgcaggtggtcgcacaggtgctatggttatgac
ttgaactctccctatgtgtggtcttcacccagtgatctcctggagctcctggtcccaggt
gtttctaagaagccatcactctcagtgcagccgggtcctgtcatggcccctggggaaagc
ctgaccctccagtgtgtctctgatgtcggctatgacagatttgttctgtacaaggagggg
gaacgtgaccttcgccagctccctggccggcagccccaggctgggctctcccaggccaac
ttcaccctgggccctgtgagccgctcctacgggggccagtacagatgctacggtgcacac
aacctctcctctgagtgctcggcccccagcgaccccctggacatcctgatcacaggacag
atccgtggcacacccttcatctcagtgcagccaggccccacagtggcctcaggagagaac
gtgaccctgctgtgtcagtcatggcggcagttccacactttccttctgaccaaggcggga
gcagctgatgccccactccgtctaagatcaatacacgaatatcctaagtaccaggctgaa
ttccccatgagtcctgtgacctcagcccacgcggggacctacaggtgctacggctcactc
aactccgacccctacctgctgtctcaccccagtgagcccctggagctcgtggtctcagga
ccctccatgggttccagccccccacccaccggtcccatctccacacctggccctgaggac
cagcccctcacccccactgggtcggatccccaaagtggtctgggaaggcacctgggggtt
gtgatcggcatcttggtggccgtcgtcctactgctcctcctcctcctcctcctcttcctc
atcctccgacatcgacgtcagggcaaacactggacatcgacccagagaaaggctgatttc
caacatcctgcaggggctgtggggccagagcccacagacagaggcctgcagtggaggtcc
agcccagctgccgacgcccaggaagaaaacctctatgctgccgtgaaggacacacagcct
gaagatggggtggagatggacactcgggctgctgcatctgaagccccccaggatgtgacc
tacgcccagctgcacagcttgaccctcagacggaaggcaactgagcctcctccatcccag
gaaagggaacctccagctgagcccagcatctacgccaccctggccatccactag

KEGG   Homo sapiens (human): 10859
Entry
10859             CDS       T01001                                 
Symbol
LILRB1, CD85J, ILT-2, ILT2, LIR-1, LIR1, MIR-7, MIR7, PIR-B, PIRB
Name
(RefSeq) leukocyte immunoglobulin like receptor B1
  KO
K06512  leukocyte immunoglobulin-like receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04380  Osteoclast differentiation
hsa04662  B cell receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04662 B cell receptor signaling pathway
    10859 (LILRB1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    10859 (LILRB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    10859 (LILRB1)
CD molecules [BR:hsa04090]
 Proteins
  10859 (LILRB1)
SSDB
Motif
Pfam: Ig_2 Ig_3 ig RIFIN Mid2 Insulin_TMD SIT Orf78
Other DBs
NCBI-GeneID: 10859
NCBI-ProteinID: NP_006660
OMIM: 604811
HGNC: 6605
Ensembl: ENSG00000104972
Pharos: Q8NHL6(Tbio)
UniProt: Q8NHL6 A0A0B4J1W1
Structure
LinkDB
Position
19:54616322..54638022
AA seq 650 aa
MTPILTVLICLGLSLGPRTHVQAGHLPKPTLWAEPGSVITQGSPVTLRCQGGQETQEYRL
YREKKTAPWITRIPQELVKKGQFPIPSITWEHTGRYRCYYGSDTAGRSESSDPLELVVTG
AYIKPTLSAQPSPVVNSGGNVTLQCDSQVAFDGFILCKEGEDEHPQCLNSQPHARGSSRA
IFSVGPVSPSRRWWYRCYAYDSNSPYEWSLPSDLLELLVLGVSKKPSLSVQPGPIVAPEE
TLTLQCGSDAGYNRFVLYKDGERDFLQLAGAQPQAGLSQANFTLGPVSRSYGGQYRCYGA
HNLSSEWSAPSDPLDILIAGQFYDRVSLSVQPGPTVASGENVTLLCQSQGWMQTFLLTKE
GAADDPWRLRSTYQSQKYQAEFPMGPVTSAHAGTYRCYGSQSSKPYLLTHPSDPLELVVS
GPSGGPSSPTTGPTSTSGPEDQPLTPTGSDPQSGLGRHLGVVIGILVAVILLLLLLLLLF
LILRHRRQGKHWTSTQRKADFQHPAGAVGPEPTDRGLQWRSSPAADAQEENLYAAVKHTQ
PEDGVEMDTRSPHDEDPQAVTYAEVKHSRPRREMASPPSPLSGEFLDTKDRQAEEDRQMD
TEAAASEAPQDVTYAQLHSLTLRREATEPPPSQEGPSPAVPSIYATLAIH
NT seq 1953 nt   +upstreamnt  +downstreamnt
atgacccccatcctcacggtcctgatctgtctcgggctgagtctgggcccccggacccac
gtgcaggcagggcacctccccaagcccaccctctgggctgaaccaggctctgtgatcacc
caggggagtcctgtgaccctcaggtgtcaggggggccaggagacccaggagtaccgtcta
tatagagaaaagaaaacagcaccctggattacacggatcccacaggagcttgtgaagaag
ggccagttccccatcccatccatcacctgggaacacacagggcggtatcgctgttactat
ggtagcgacactgcaggccgctcagagagcagtgaccccctggagctggtggtgacagga
gcctacatcaaacccaccctctcagcccagcccagccccgtggtgaactcaggagggaat
gtaaccctccagtgtgactcacaggtggcatttgatggcttcattctgtgtaaggaagga
gaagatgaacacccacaatgcctgaactcccagccccatgcccgtgggtcgtcccgcgcc
atcttctccgtgggccccgtgagcccgagtcgcaggtggtggtacaggtgctatgcttat
gactcgaactctccctatgagtggtctctacccagtgatctcctggagctcctggtccta
ggtgtttctaagaagccatcactctcagtgcagccaggtcctatcgtggcccctgaggag
accctgactctgcagtgtggctctgatgctggctacaacagatttgttctgtataaggac
ggggaacgtgacttccttcagctcgctggcgcacagccccaggctgggctctcccaggcc
aacttcaccctgggccctgtgagccgctcctacgggggccagtacagatgctacggtgca
cacaacctctcctccgagtggtcggcccccagcgaccccctggacatcctgatcgcagga
cagttctatgacagagtctccctctcggtgcagccgggccccacggtggcctcaggagag
aacgtgaccctgctgtgtcagtcacagggatggatgcaaactttccttctgaccaaggag
ggggcagctgatgacccatggcgtctaagatcaacgtaccaatctcaaaaataccaggct
gaattccccatgggtcctgtgacctcagcccatgcggggacctacaggtgctacggctca
cagagctccaaaccctacctgctgactcaccccagtgaccccctggagctcgtggtctca
ggaccgtctgggggccccagctccccgacaacaggccccacctccacatctggccctgag
gaccagcccctcacccccaccgggtcggatccccagagtggtctgggaaggcacctgggg
gttgtgatcggcatcttggtggccgtcatcctactgctcctcctcctcctcctcctcttc
ctcatcctccgacatcgacgtcagggcaaacactggacatcgacccagagaaaggctgat
ttccaacatcctgcaggggctgtggggccagagcccacagacagaggcctgcagtggagg
tccagcccagctgccgatgcccaggaagaaaacctctatgctgccgtgaagcacacacag
cctgaggatggggtggagatggacactcggagcccacacgatgaagacccccaggcagtg
acgtatgccgaggtgaaacactccagacctaggagagaaatggcctctcctccttcccca
ctgtctggggaattcctggacacaaaggacagacaggcggaagaggacaggcagatggac
actgaggctgctgcatctgaagccccccaggatgtgacctacgcccagctgcacagcttg
accctcagacgggaggcaactgagcctcctccatcccaggaagggccctctccagctgtg
cccagcatctacgccactctggccatccactag

KEGG   Homo sapiens (human): 10990
Entry
10990             CDS       T01001                                 
Symbol
LILRB5, CD85C, LIR-8, LIR8
Name
(RefSeq) leukocyte immunoglobulin like receptor B5
  KO
K06512  leukocyte immunoglobulin-like receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04380  Osteoclast differentiation
hsa04662  B cell receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04662 B cell receptor signaling pathway
    10990 (LILRB5)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    10990 (LILRB5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    10990 (LILRB5)
CD molecules [BR:hsa04090]
 Proteins
  10990 (LILRB5)
SSDB
Motif
Pfam: Ig_2 Ig_3 ig
Other DBs
NCBI-GeneID: 10990
NCBI-ProteinID: NP_006831
OMIM: 604814
HGNC: 6609
Ensembl: ENSG00000105609
Pharos: O75023(Tbio)
UniProt: O75023
LinkDB
Position
19:complement(54249421..54257609)
AA seq 590 aa
MTLTLSVLICLGLSVGPRTCVQAGTLPKPTLWAEPASVIARGKPVTLWCQGPLETEEYRL
DKEGLPWARKRQNPLEPGAKAKFHIPSTVYDSAGRYRCYYETPAGWSEPSDPLELVATGF
YAEPTLLALPSPVVASGGNVTLQCDTLDGLLTFVLVEEEQKLPRTLYSQKLPKGPSQALF
PVGPVTPSCRWRFRCYYYYRKNPQVWSNPSDLLEILVPGVSRKPSLLIPQGSVVARGGSL
TLQCRSDVGYDIFVLYKEGEHDLVQGSGQQPQAGLSQANFTLGPVSRSHGGQYRCYGAHN
LSPRWSAPSDPLDILIAGLIPDIPALSVQPGPKVASGENVTLLCQSWHQIDTFFLTKEGA
AHPPLCLKSKYQSYRHQAEFSMSPVTSAQGGTYRCYSAIRSYPYLLSSPSYPQELVVSGP
SGDPSLSPTGSTPTPGPEDQPLTPTGLDPQSGLGRHLGVVTGVSVAFVLLLFLLLFLLLR
HRHQSKHRTSAHFYRPAGAAGPEPKDQGLQKRASPVADIQEEILNAAVKDTQPKDGVEMD
APAAASEAPQDVTYAQLHSLTLRREATEPPPSQEREPPAEPSIYAPLAIH
NT seq 1773 nt   +upstreamnt  +downstreamnt
atgaccctcaccctctcagtcctgatttgcctcgggctgagtgtgggccccaggacctgc
gtgcaggcaggcaccctccccaaacccaccctctgggctgagccagcctctgtgatagct
cgggggaagcccgtgaccctctggtgtcaggggcccctggagactgaggagtaccgtctg
gataaggagggactcccatgggcccggaagagacagaacccactggagcctggagccaag
gccaagttccacattccatccacggtgtatgacagtgcagggcgataccgctgctactat
gagacccctgcaggctggtcagagcccagtgaccccctggagctggtggcgacaggattc
tatgcagaacccactcttttagccctgccgagtcctgtggtggcctcaggaggaaatgtg
accctccagtgtgatacactggacggacttctcacgtttgttcttgttgaggaagaacag
aagctccccaggaccctgtactcacagaagctccccaaagggccatcccaggccctgttc
cctgtgggtcccgtgacccccagctgcaggtggaggttcagatgctattactattacagg
aaaaaccctcaggtgtggtcgaaccccagtgacctcctggagattctggtcccaggcgtg
tctaggaagccctccctcctgatcccgcagggctctgtcgtggcccgcggaggcagcctg
accctgcagtgtcgctctgatgtcggctatgacatattcgttctgtacaaggagggggaa
catgacctcgtccagggctctggccagcagccccaggctgggctctcccaggccaacttc
accctgggccctgtgagccgctcccacgggggccagtacagatgctacggtgcacacaac
ctctcccctaggtggtcggcccccagcgaccccctggacatcctgatcgcaggactgatc
cctgacatacccgccctctcggtgcagccgggccccaaggtggcctcaggagagaacgtg
accctgctgtgtcagtcatggcatcagatagacactttctttttgaccaaggagggggca
gcccatcccccgctgtgtctaaagtcaaagtaccagtcttatagacaccaggctgaattc
tccatgagtcctgtgacctcagcccagggtggaacctaccgatgctacagcgcaatcagg
tcctacccctacctgctgtccagccctagttacccccaggagctcgtggtctcaggaccc
tctggggatcccagcctctcacctacaggctccacccccacacctggccctgaggaccag
cccctcacccccacggggttggatccccagagtggtctgggaaggcacctgggggttgtg
actggggtctcagtggccttcgtcctgctgctgttcctcctcctcttcctcctcctccga
catcggcatcagagcaaacacaggacatcggcccatttctaccgtcctgcaggggctgcg
gggccagagcccaaggaccagggcctgcagaagagggccagcccagttgctgacatccag
gaggaaattctcaatgctgccgtgaaggacacacagcccaaggacggggtggagatggat
gctccggctgctgcatctgaagccccccaggatgtgacctacgcccagctgcacagcttg
accctcagacgggaggcaactgagcctcctccatcccaggaaagggaacctccagctgaa
cccagcatctacgcccccctggccatccactag

KEGG   Homo sapiens (human): 11006
Entry
11006             CDS       T01001                                 
Symbol
LILRB4, B4, CD85K, ILT-3, ILT3, LIR-5, LIR5
Name
(RefSeq) leukocyte immunoglobulin like receptor B4
  KO
K06512  leukocyte immunoglobulin-like receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04380  Osteoclast differentiation
hsa04662  B cell receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04662 B cell receptor signaling pathway
    11006 (LILRB4)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    11006 (LILRB4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    11006 (LILRB4)
CD molecules [BR:hsa04090]
 Proteins
  11006 (LILRB4)
SSDB
Motif
Pfam: Ig_2 ig Ig_3 DUF4808
Other DBs
NCBI-GeneID: 11006
NCBI-ProteinID: NP_001265355
OMIM: 604821
HGNC: 6608
Ensembl: ENSG00000186818
Pharos: Q8NHJ6(Tbio)
UniProt: Q8NHJ6
Structure
LinkDB
Position
19:54662985..54668718
AA seq 448 aa
MIPTFTALLCLGLSLGPRTHMQAGPLPKPTLWAEPGSVISWGNSVTIWCQGTLEAREYRL
DKEESPAPWDRQNPLEPKNKARFSIPSMTEDYAGRYRCYYRSPVGWSQPSDPLELVMTGA
YSKPTLSALPSPLVTSGKSVTLLCQSRSPMDTFLLIKERAAHPLLHLRSEHGAQQHQAEF
PMSPVTSVHGGTYRCFSSHGFSHYLLSHPSDPLELIVSGSLEGPRPSPTRSVSTAAGPED
QPLMPTGSVPHSGLRRHWEVLIGVLVVSILLLSLLLFLLLQHWRQGKHRTLAQRQADFQR
PPGAAEPEPKDGGLQRRSSPAADVQGENFCAAVKNTQPEDGVEMDTRQSPHDEDPQAVTY
AKVKHSRPRREMASPPSPLSGEFLDTKDRQAEEDRQMDTEAAASEAPQDVTYARLHSFTL
RQKATEPPPSQEGASPAEPSVYATLAIH
NT seq 1347 nt   +upstreamnt  +downstreamnt
atgatccccaccttcacggctctgctctgcctcgggctgagtctgggccccaggacccac
atgcaggcagggcccctccccaaacccaccctctgggctgagccaggctctgtgatcagc
tgggggaactctgtgaccatctggtgtcaggggaccctggaggctcgggagtaccgtctg
gataaagaggaaagcccagcaccctgggacagacagaacccactggagcccaagaacaag
gccagattctccatcccatccatgacagaggactatgcagggagataccgctgttactat
cgcagccctgtaggctggtcacagcccagtgaccccctggagctggtgatgacaggagcc
tacagtaaacccaccctttcagccctgccgagtcctcttgtgacctcaggaaagagcgtg
accctgctgtgtcagtcacggagcccaatggacacttttcttctgatcaaggagcgggca
gcccatcccctactgcatctgagatcagagcacggagctcagcagcaccaggctgaattc
cccatgagtcctgtgacctcagtgcacggggggacctacaggtgcttcagctcacacggc
ttctcccactacctgctgtcacaccccagtgaccccctggagctcatagtctcaggatcc
ttggagggtcccaggccctcacccacaaggtccgtctcaacagctgcaggccctgaggac
cagcccctcatgcctacagggtcagtcccccacagtggtctgagaaggcactgggaggta
ctgatcggggtcttggtggtctccatcctgcttctctccctcctcctcttcctcctcctc
caacactggcgtcagggaaaacacaggacattggcccagagacaggctgatttccaacgt
cctccaggggctgccgagccagagcccaaggacgggggcctacagaggaggtccagccca
gctgctgacgtccagggagaaaacttctgtgctgccgtgaagaacacacagcctgaggac
ggggtggaaatggacactcggcagagcccacacgatgaagacccccaggcagtgacgtat
gccaaggtgaaacactccagacctaggagagaaatggcctctcctccctccccactgtct
ggggaattcctggacacaaaggacagacaggcagaagaggacagacagatggacactgag
gctgctgcatctgaagccccccaggatgtgacctacgcccggctgcacagctttaccctc
agacagaaggcaactgagcctcctccatcccaggaaggggcctctccagctgagcccagt
gtctatgccactctggccatccactaa

KEGG   Homo sapiens (human): 11024
Entry
11024             CDS       T01001                                 
Symbol
LILRA1, CD85I, LIR-6, LIR6
Name
(RefSeq) leukocyte immunoglobulin like receptor A1
  KO
K06512  leukocyte immunoglobulin-like receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04380  Osteoclast differentiation
hsa04662  B cell receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04662 B cell receptor signaling pathway
    11024 (LILRA1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    11024 (LILRA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    11024 (LILRA1)
CD molecules [BR:hsa04090]
 Proteins
  11024 (LILRA1)
SSDB
Motif
Pfam: Ig_2 Ig_3 ig
Other DBs
NCBI-GeneID: 11024
NCBI-ProteinID: NP_006854
OMIM: 604810
HGNC: 6602
Ensembl: ENSG00000104974
Pharos: O75019(Tdark)
UniProt: O75019
LinkDB
Position
19:54593632..54602381
AA seq 489 aa
MTPIVTVLICLRLSLGPRTHVQAGTLPKPTLWAEPGSVITQGSPVTLWCQGILETQEYRL
YREKKTAPWITRIPQEIVKKGQFPIPSITWEHTGRYRCFYGSHTAGWSEPSDPLELVVTG
AYIKPTLSALPSPVVTSGGNVTLHCVSQVAFGSFILCKEGEDEHPQCLNSQPRTHGWSRA
IFSVGPVSPSRRWSYRCYAYDSNSPHVWSLPSDLLELLVLGVSKKPSLSVQPGPIVAPGE
SLTLQCVSDVSYDRFVLYKEGERDFLQLPGPQPQAGLSQANFTLGPVSRSYGGQYRCSGA
YNLSSEWSAPSDPLDILIAGQFRGRPFISVHPGPTVASGENVTLLCQSWGPFHTFLLTKA
GAADAPLRLRSIHEYPKYQAEFPMSPVTSAHSGTYRCYGSLSSNPYLLSHPSDSLELMVS
GAAETLSPPQNKSDSKAGAANTLSPSQNKTASHPQDYTVENLIRMGIAGLVLVVLGILLF
EAQHSQRSL
NT seq 1470 nt   +upstreamnt  +downstreamnt
atgacccccatcgtcacagtcctgatctgtctcaggctgagtctgggcccccggacccac
gtgcaggcagggaccctccccaagcccacactctgggctgagccaggctctgtgatcacc
caggggagtcccgtgaccctctggtgtcaggggatcctggagacccaggagtaccgtctg
tatagagaaaagaaaacagcaccctggattacacggatcccacaggagattgtgaagaag
ggccagttccccatcccatccatcacctgggaacacacagggcggtatcgctgtttctac
ggtagccacactgcaggctggtcagagcccagtgaccccctggagctggtggtgacagga
gcctacatcaaacccaccctctcagctctacccagccctgtggtgacctcaggagggaac
gtgaccctccattgtgtctcacaggtggcatttggcagcttcattctgtgtaaggaagga
gaagatgaacacccacaatgcctgaactcacagccccgtacccatgggtggtcccgggcc
atcttctctgtgggccccgtgagcccgagtcgcaggtggtcgtacaggtgctatgcttat
gactcgaactctccccatgtgtggtctctacccagtgatctcctggagctcctggtccta
ggtgtttctaagaagccatcactctcagtgcagccaggtcctatagtggcccctggggag
agcctgaccctccagtgtgtttctgatgtcagctacgacagatttgttctgtataaggag
ggagaacgtgacttcctccagctccctggcccacagccccaggctgggctctcccaggcc
aacttcaccctgggccctgtgagccgctcctacgggggccagtacagatgctccggtgca
tacaacctctcctccgagtggtcggcccccagcgaccccctggacatcctgatcgcagga
cagttccgtggcagacccttcatctcggtgcatccgggccccacggtggcctcaggagag
aacgtgaccctgctgtgtcagtcatgggggccgttccacactttccttctgaccaaggcg
ggagcagctgatgcccccctccgtctcagatcaatacacgaatatcctaagtaccaggct
gaattccctatgagtcctgtgacctcagcccactcggggacctacaggtgctacggctca
ctcagctccaacccctacctgctgtctcaccccagtgactccctggagctcatggtctca
ggagcagctgagaccctcagcccaccacaaaacaagtccgattccaaggctggagcagct
aacaccctcagcccatcacaaaacaagactgcctcacacccccaggattacacagtggag
aatctcatccgcatgggcatagctggcttggtcctggtggtcctcgggattctgctattt
gaggctcagcacagccagagaagcctctga

KEGG   Homo sapiens (human): 11025
Entry
11025             CDS       T01001                                 
Symbol
LILRB3, CD85A, HL9, ILT-5, ILT5, LILRA6, LIR-3, LIR3, PIR-B, PIRB
Name
(RefSeq) leukocyte immunoglobulin like receptor B3
  KO
K06512  leukocyte immunoglobulin-like receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04380  Osteoclast differentiation
hsa04662  B cell receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04662 B cell receptor signaling pathway
    11025 (LILRB3)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    11025 (LILRB3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    11025 (LILRB3)
CD molecules [BR:hsa04090]
 Proteins
  11025 (LILRB3)
SSDB
Motif
Pfam: Ig_2 Ig_3 ig
Other DBs
NCBI-GeneID: 11025
NCBI-ProteinID: NP_001074919
OMIM: 604820
HGNC: 6607
Ensembl: ENSG00000204577
UniProt: O75022
LinkDB
Position
19:complement(54216278..54223007)
AA seq 632 aa
MTPALTALLCLGLSLGPRTRMQAGPFPKPTLWAEPGSVISWGSPVTIWCQGSLEAQEYQL
DKEGSPEPWDRNNPLEPKNKARFSIPSMTQHHAGRYRCHYYSSAGWSEPSDPLELVMTGF
YNKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSGGFQAL
FPVGPVTPSHRWRFTCYYYYTNTPWVWSHPSDPLEILPSGVSRKPSLLTLQGPVLAPGQS
LTLQCGSDVGYDRFVLYKEGERDFLQRPGQQPQAGLSQANFTLGPVSRSYGGQYRCYGAH
NLSSEWSAPSDPLDILITGQIYDTVSLSAQPGPTVASGENMTLLCQSRGYFDTFLLTKEG
AAHPPLRLRSMYGAHKYQAEFPMSPVTSAHAGTYRCYGSRSSNPHLLSFPSEPLELMVSG
HSGGSSLPPTGPPSTPGLGRYLEVLIGVSVAFVLLLFLLLFLLLLRQRHSKHRTSDQRKT
DFQRPAGAAETEPKDRGLLRRSSPAADVQEENLYAAVKDTQSEDRVELDSQQSPHDEDPQ
AVTYAPVKHSSPRREMASPPSSLSGEFLDTKDRQVEEDRQMDTEAAASEASQDVTYAQLH
SLTLRRKATEPPPSQEGEPPAEPSIYATLAIH
NT seq 1899 nt   +upstreamnt  +downstreamnt
atgacgcccgccctcacagccctgctctgccttgggctgagtctgggccccaggacccgc
atgcaggcagggcccttccccaaacccaccctctgggctgagccaggctctgtgatcagc
tgggggagccccgtgaccatctggtgtcaggggagcctggaggcccaggagtaccaactg
gataaagagggaagcccagagccctgggacagaaataacccactggaacccaagaacaag
gccagattctccatcccatccatgacacagcaccatgcagggagataccgctgccactat
tacagctctgcaggctggtcagagcccagcgaccccctggagctggtgatgacaggattc
tacaacaaacccaccctctcagccctgcccagccctgtggtggcctcaggggggaatatg
accctccgatgtggctcacagaagggatatcaccattttgttctgatgaaggaaggagaa
caccagctcccccggaccctggactcacagcagctccacagtggggggttccaggccctg
ttccctgtgggccccgtgacccccagccacaggtggaggttcacatgctattactattat
acaaacaccccctgggtgtggtcccaccccagtgaccccctggagattctgccctcaggc
gtgtctaggaagccctccctcctgaccctgcagggccctgtcctggcccctgggcagagc
ctgaccctccagtgtggctctgatgtcggctacgacagatttgttctgtataaggagggg
gaacgtgacttcctccagcgccctggccagcagccccaggctgggctctcccaggccaac
ttcaccctgggccctgtgagccgctcctacgggggccagtacaggtgctatggtgcacac
aacctctcctccgagtggtcggcccccagtgaccccctggacatcctgatcacaggacag
atctatgacaccgtctccctgtcagcacagccgggccccacagtggcctcaggagagaac
atgaccctgctgtgtcagtcacgggggtattttgacactttccttctgaccaaagaaggg
gcagcccatcccccactgcgtctgagatcaatgtacggagctcataagtaccaggctgaa
ttccccatgagtcctgtgacctcagcccacgcggggacctacaggtgctacggctcacgc
agctccaacccccacctgctgtctttccccagtgagcccctggaactcatggtctcagga
cactctggaggctccagcctcccacccacagggccgccctccacacctggtctgggaaga
tacctggaggttttgattggggtctcggtggccttcgtcctgctgctcttcctcctcctc
ttcctcctcctcctccgtcagcgtcacagcaaacacaggacatctgaccagagaaagact
gatttccagcgtcctgcaggggctgcggagacagagcccaaggacaggggcctgctgagg
aggtccagcccagctgctgacgtccaggaagaaaacctctatgctgctgtgaaggacaca
cagtctgaggacagggtggagctggacagtcagcagagcccacacgatgaagacccccag
gcagtgacgtatgccccggtgaaacactccagtcctaggagagaaatggcctctcctccc
tcctcactgtctggggaattcctggacacaaaggacagacaggtggaagaggacaggcag
atggacactgaggctgctgcatctgaagcctcccaggatgtgacctacgcccagctgcac
agcttgacccttagacggaaggcaactgagcctcctccatcccaggaaggggaacctcca
gctgagcccagcatctacgccactctggccatccactag

KEGG   Homo sapiens (human): 11026
Entry
11026             CDS       T01001                                 
Symbol
LILRA3, CD85E, HM31, HM43, ILT-6, ILT6, LIR-4, LIR4
Name
(RefSeq) leukocyte immunoglobulin like receptor A3
  KO
K06512  leukocyte immunoglobulin-like receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04380  Osteoclast differentiation
hsa04662  B cell receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04662 B cell receptor signaling pathway
    11026 (LILRA3)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    11026 (LILRA3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    11026 (LILRA3)
CD molecules [BR:hsa04090]
 Proteins
  11026 (LILRA3)
SSDB
Motif
Pfam: Ig_2 Ig_3 ig
Other DBs
NCBI-GeneID: 11026
NCBI-ProteinID: NP_006856
OMIM: 604818
HGNC: 6604
Pharos: Q8N6C8(Tbio)
UniProt: Q8N6C8
Structure
LinkDB
Position
19q13.4
AA seq 439 aa
MTPILTVLICLGLSLDPRTHVQAGPLPKPTLWAEPGSVITQGSPVTLRCQGSLETQEYHL
YREKKTALWITRIPQELVKKGQFPILSITWEHAGRYCCIYGSHTAGLSESSDPLELVVTG
AYSKPTLSALPSPVVTSGGNVTIQCDSQVAFDGFILCKEGEDEHPQCLNSHSHARGSSRA
IFSVGPVSPSRRWSYRCYGYDSRAPYVWSLPSDLLGLLVPGVSKKPSLSVQPGPVVAPGE
KLTFQCGSDAGYDRFVLYKEWGRDFLQRPGRQPQAGLSQANFTLGPVSRSYGGQYTCSGA
YNLSSEWSAPSDPLDILITGQIRARPFLSVRPGPTVASGENVTLLCQSQGGMHTFLLTKE
GAADSPLRLKSKRQSHKYQAEFPMSPVTSAHAGTYRCYGSLSSNPYLLTHPSDPLELVVS
GAAETLSPPQNKSDSKAGE
NT seq 1320 nt   +upstreamnt  +downstreamnt
atgacccccatcctcacggtcctgatctgtctcgggctgagcctggaccccaggacccac
gtgcaggcagggcccctccccaagcccaccctctgggctgagccaggctctgtgatcacc
caagggagtcctgtgaccctcaggtgtcaggggagcctggagacgcaggagtaccatcta
tatagagaaaagaaaacagcactctggattacacggatcccacaggagcttgtgaagaag
ggccagttccccatcctatccatcacctgggaacatgcagggcggtattgctgtatctat
ggcagccacactgcaggcctctcagagagcagtgaccccctggagctggtggtgacagga
gcctacagcaaacccaccctctcagctctgcccagccctgtggtgacctcaggagggaat
gtgaccatccagtgtgactcacaggtggcatttgatggcttcattctgtgtaaggaagga
gaagatgaacacccacaatgcctgaactcccattcccatgcccgtgggtcatcccgggcc
atcttctccgtgggccccgtgagcccaagtcgcaggtggtcgtacaggtgctatggttat
gactcgcgcgctccctatgtgtggtctctacccagtgatctcctggggctcctggtccca
ggtgtttctaagaagccatcactctcagtgcagccgggtcctgtcgtggcccctggggag
aagctgaccttccagtgtggctctgatgccggctacgacagatttgttctgtacaaggag
tggggacgtgacttcctccagcgccctggccggcagccccaggctgggctctcccaggcc
aacttcaccctgggccctgtgagccgctcctacgggggccagtacacatgctccggtgca
tacaacctctcctccgagtggtcggcccccagcgaccccctggacatcctgatcacagga
cagatccgtgccagacccttcctctccgtgcggccgggccccacagtggcctcaggagag
aacgtgaccctgctgtgtcagtcacagggagggatgcacactttccttttgaccaaggag
ggggcagctgattccccgctgcgtctaaaatcaaagcgccaatctcataagtaccaggct
gaattccccatgagtcctgtgacctcggcccacgcggggacctacaggtgctacggctca
ctcagctccaacccctacctgctgactcaccccagtgaccccctggagctcgtggtctca
ggagcagctgagaccctcagcccaccacaaaacaagtccgactccaaggctggtgagtga

KEGG   Homo sapiens (human): 11027
Entry
11027             CDS       T01001                                 
Symbol
LILRA2, CD85H, ILT1, LIR-7, LIR7
Name
(RefSeq) leukocyte immunoglobulin like receptor A2
  KO
K06512  leukocyte immunoglobulin-like receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04380  Osteoclast differentiation
hsa04662  B cell receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04662 B cell receptor signaling pathway
    11027 (LILRA2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    11027 (LILRA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    11027 (LILRA2)
CD molecules [BR:hsa04090]
 Proteins
  11027 (LILRA2)
SSDB
Motif
Pfam: Ig_2 Ig_3 ig
Other DBs
NCBI-GeneID: 11027
NCBI-ProteinID: NP_006857
OMIM: 604812
HGNC: 6603
Ensembl: ENSG00000239998
Pharos: Q8N149(Tbio)
UniProt: Q8N149
Structure
LinkDB
Position
19:54572988..54590287
AA seq 466 aa
MTPILTVLICLGLSLGPRTHVQAGHLPKPTLWAEPGSVIIQGSPVTLRCQGSLQAEEYHL
YRENKSASWVRRIQEPGKNGQFPIPSITWEHAGRYHCQYYSHNHSSEYSDPLELVVTGAY
SKPTLSALPSPVVTSGGNVTLQCVSQVAFDGFILCKEGEDEHPQRLNSHSHARGWSWAIF
SVGPVSPSRRWSYRCYAYDSNSPYVWSLPSDLLELLVPGVSKKPSLSVQPGPMVAPGESL
TLQCVSDVGYDRFVLYKEGERDFLQRPGWQPQAGLSQANFTLGPVSPSHGGQYRCYSAHN
LSSEWSAPSDPLDILITGQFYDRPSLSVQPVPTVAPGKNVTLLCQSRGQFHTFLLTKEGA
GHPPLHLRSEHQAQQNQAEFRMGPVTSAHVGTYRCYSSLSSNPYLLSLPSDPLELVVSAS
LGQHPQDYTVENLIRMGVAGLVLVVLGILLFEAQHSQRSLQDAAGR
NT seq 1401 nt   +upstreamnt  +downstreamnt
atgacccccatcctcacggtcctgatctgtctcgggctgagtctgggccccaggacccac
gtgcaggcagggcacctccccaagcccaccctctgggctgagccaggctctgtgatcatc
cagggaagtcctgtgaccctcaggtgtcaggggagccttcaggctgaggagtaccatcta
tatagggaaaacaaatcagcatcctgggttagacggatacaagagcctgggaagaatggc
cagttccccatcccatccatcacctgggaacacgcagggcggtatcactgtcagtactac
agccacaatcactcatcagagtacagtgaccccctggagctggtggtgacaggagcctac
agcaaacccaccctctcagctctgcccagccctgtggtgacctcaggagggaacgtgacc
ctccagtgtgtctcacaggtggcatttgacggcttcattctgtgtaaggaaggagaagat
gaacacccacaacgcctgaactcccattcccatgcccgtgggtggtcctgggccatcttc
tccgtgggccccgtgagcccgagtcgcaggtggtcgtacaggtgctatgcttatgactcg
aactctccctatgtgtggtctctacccagtgatctcctggagctcctggtcccaggtgtt
tctaagaagccatcactctcagtgcagccaggtcctatggtggcccctggggagagcctg
accctccagtgtgtctctgatgtcggctacgacagatttgttctgtataaggagggagaa
cgtgacttcctccagcgccctggttggcagccccaggctgggctctcccaggccaacttc
accctgggccctgtgagcccctcccacgggggccagtacagatgctacagtgcacacaac
ctctcctccgagtggtcggcccccagtgaccccctggacatcctgatcacaggacagttc
tatgacagaccctctctctcggtgcagccggtccccacagtagccccaggaaagaacgtg
accctgctgtgtcagtcacgggggcagttccacactttccttctgaccaaggagggggca
ggccatcccccactgcatctgagatcagagcaccaagctcagcagaaccaggctgaattc
cgcatgggtcctgtgacctcagcccacgtggggacctacagatgctacagctcactcagc
tccaacccctacctgctgtctctccccagtgaccccctggagctcgtggtctcagcatcc
ctaggccaacacccccaggattacacagtggagaatctcatccgcatgggtgtggctggc
ttggtcctggtggtcctcgggattctgctatttgaggctcagcacagccagagaagccta
caagatgcagccgggaggtga

KEGG   Homo sapiens (human): 23547
Entry
23547             CDS       T01001                                 
Symbol
LILRA4, CD85g, ILT7
Name
(RefSeq) leukocyte immunoglobulin like receptor A4
  KO
K06512  leukocyte immunoglobulin-like receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04380  Osteoclast differentiation
hsa04662  B cell receptor signaling pathway
Drug target
Daxdilimab: D11778
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04662 B cell receptor signaling pathway
    23547 (LILRA4)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    23547 (LILRA4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    23547 (LILRA4)
CD molecules [BR:hsa04090]
 Proteins
  23547 (LILRA4)
SSDB
Motif
Pfam: Ig_2 ig Ig_3
Other DBs
NCBI-GeneID: 23547
NCBI-ProteinID: NP_036408
OMIM: 607517
HGNC: 15503
Ensembl: ENSG00000239961
Pharos: P59901(Tbio)
UniProt: P59901
LinkDB
Position
19:complement(54333185..54339162)
AA seq 499 aa
MTLILTSLLFFGLSLGPRTRVQAENLLKPILWAEPGPVITWHNPVTIWCQGTLEAQGYRL
DKEGNSMSRHILKTLESENKVKLSIPSMMWEHAGRYHCYYQSPAGWSEPSDPLELVVTAY
SRPTLSALPSPVVTSGVNVTLRCASRLGLGRFTLIEEGDHRLSWTLNSHQHNHGKFQALF
PMGPLTFSNRGTFRCYGYENNTPYVWSEPSDPLQLLVSGVSRKPSLLTLQGPVVTPGENL
TLQCGSDVGYIRYTLYKEGADGLPQRPGRQPQAGLSQANFTLSPVSRSYGGQYRCYGAHN
VSSEWSAPSDPLDILIAGQISDRPSLSVQPGPTVTSGEKVTLLCQSWDPMFTFLLTKEGA
AHPPLRLRSMYGAHKYQAEFPMSPVTSAHAGTYRCYGSRSSNPYLLSHPSEPLELVVSGA
TETLNPAQKKSDSKTAPHLQDYTVENLIRMGVAGLVLLFLGILLFEAQHSQRSPPRCSQE
ANSRKDNAPFRVVEPWEQI
NT seq 1500 nt   +upstreamnt  +downstreamnt
atgaccctcattctcacaagcctgctcttctttgggctgagcctgggccccaggacccgg
gtgcaggcagaaaacctactcaaacccatcctgtgggccgagccaggtcccgtgatcacc
tggcataaccccgtgaccatctggtgtcagggcaccctggaggcccaggggtaccgtctg
gataaagagggaaactcaatgtcgaggcacatattaaaaacactggagtctgaaaacaag
gtcaaactctccatcccatccatgatgtgggaacatgcagggcgatatcactgttactat
cagagccctgcaggctggtcagagcccagcgaccccctggagctggtggtgacagcctac
agcagacccaccctgtccgcactgccaagccctgtggtgacctcaggagtgaacgtgacc
ctccggtgtgcctcacggctgggactgggcaggttcactctgattgaggaaggagaccac
aggctctcctggaccctgaactcacaccaacacaaccatggaaagttccaggccctgttc
cccatgggccccctgaccttcagcaacaggggtacattcagatgctacggctatgaaaac
aacaccccatacgtgtggtcggaacccagtgaccccctgcagctactggtgtcaggcgtg
tctaggaagccctccctcctgaccctgcagggccctgtcgtgacccccggagagaatctg
accctccagtgtggctctgatgtcggctacatcagatacactctgtacaaggagggggcc
gatggcctcccccagcgccctggccggcagccccaggctgggctctcccaggccaacttc
accctgagccctgtgagccgctcctacgggggccagtacagatgctacggcgcacacaac
gtctcctccgagtggtcggcccccagtgaccccctggatatcctgatcgcaggacagatc
tctgacagaccctccctctcagtgcagccgggccccacggtgacctcaggagagaaggtg
accctgctgtgtcagtcatgggacccgatgttcactttccttctgaccaaggagggggca
gcccatcccccgttgcgtctgagatcaatgtacggagctcataagtaccaggctgaattc
cccatgagtcctgtgacctcagcccacgcggggacctacaggtgctacggctcacgcagc
tccaacccctacctgctgtctcaccccagtgagcccctggagctcgtggtctcaggagca
actgagaccctcaatccagcacaaaagaagtcagattccaagactgccccacacctccag
gattacacagtggagaatctcatccgcatgggtgtggctggcttggtcctgctgttcctc
gggattctgttatttgaggctcagcacagccagagaagccccccaaggtgcagccaggag
gcaaacagcagaaaggacaatgcacccttcagagtggtggagccttgggaacagatctga

DBGET integrated database retrieval system