KEGG   Homo sapiens (human): 10344
Entry
10344             CDS       T01001                                 
Symbol
CCL26, IMAC, MIP-4a, MIP-4alpha, SCYA26, TSC-1
Name
(RefSeq) C-C motif chemokine ligand 26
  KO
K21096  C-C motif chemokine 26
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
Network
nt06150  Cytokine-cytokine receptor interaction (viruses)
  Element
N01181  CCL5/7/11/13/15/24/26/27/28 to CCR3 signaling
N01183  CCL5/11/13/26/28 to HCMV US28 signaling
N01186  HSV1 SgG1 to CCR signaling
N01187  HSV2 SgG2 to CCR signaling
Disease
H01360  Allergic rhinitis
H01361  Eosinophilic esophagitis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    10344 (CCL26)
   04061 Viral protein interaction with cytokine and cytokine receptor
    10344 (CCL26)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    10344 (CCL26)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    10344 (CCL26)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   10344 (CCL26)
SSDB
Motif
Pfam: IL8 Gln_deamidase_2
Other DBs
NCBI-GeneID: 10344
NCBI-ProteinID: NP_006063
OMIM: 604697
HGNC: 10625
Ensembl: ENSG00000006606
Pharos: Q9Y258(Tbio)
UniProt: Q9Y258
Structure
LinkDB
Position
7:complement(75769524..75791597)
AA seq 94 aa
MMGLSLASAVLLASLLSLHLGTATRGSDISKTCCFQYSHKPLPWTWVRSYEFTSNSCSQR
AVIFTTKRGKKVCTHPRKKWVQKYISLLKTPKQL
NT seq 285 nt   +upstreamnt  +downstreamnt
atgatgggcctctccttggcctctgctgtgctcctggcctccctcctgagtctccacctt
ggaactgccacacgtgggagtgacatatccaagacctgctgcttccaatacagccacaag
ccccttccctggacctgggtgcgaagctatgaattcaccagtaacagctgctcccagcgg
gctgtgatattcactaccaaaagaggcaagaaagtctgtacccatccaaggaaaaaatgg
gtgcaaaaatacatttctttactgaaaactccgaaacaattgtga

KEGG   Homo sapiens (human): 10850
Entry
10850             CDS       T01001                                 
Symbol
CCL27, ALP, CTACK, CTAK, ESKINE, ILC, PESKY, SCYA27
Name
(RefSeq) C-C motif chemokine ligand 27
  KO
K16598  C-C motif chemokine 27
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
Network
nt06150  Cytokine-cytokine receptor interaction (viruses)
  Element
N01173  CCL2/7/8/13/27 to CCR2 signaling
N01181  CCL5/7/11/13/15/24/26/27/28 to CCR3 signaling
N01225  CCL27/28 to CCR10 signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    10850 (CCL27)
   04061 Viral protein interaction with cytokine and cytokine receptor
    10850 (CCL27)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    10850 (CCL27)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    10850 (CCL27)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   10850 (CCL27)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 10850
NCBI-ProteinID: NP_006655
OMIM: 604833
HGNC: 10626
Ensembl: ENSG00000213927
Pharos: Q9Y4X3(Tbio)
UniProt: Q9Y4X3 Q5VZ77
Structure
LinkDB
Position
9:complement(34661890..34662657)
AA seq 112 aa
MKGPPTFCSLLLLSLLLSPDPTAAFLLPPSTACCTQLYRKPLSDKLLRKVIQVELQEADG
DCHLQAFVLHLAQRSICIHPQNPSLSQWFEHQERKLHGTLPKLNFGMLRKMG
NT seq 339 nt   +upstreamnt  +downstreamnt
atgaaggggcccccaaccttctgcagcctcctgctgctgtcattgctcctgagcccagac
cctacagcagcattcctactgccacccagcactgcctgctgtactcagctctaccgaaag
ccactctcagacaagctactgaggaaggtcatccaggtggaactgcaggaggctgacggg
gactgtcacctccaggctttcgtgcttcacctggctcaacgcagcatctgcatccacccc
cagaaccccagcctgtcacagtggtttgagcaccaagagagaaagctccatgggactctg
cccaagctgaattttgggatgctaaggaaaatgggctga

KEGG   Homo sapiens (human): 56477
Entry
56477             CDS       T01001                                 
Symbol
CCL28, CCK1, MEC, SCYA28
Name
(RefSeq) C-C motif chemokine ligand 28
  KO
K05513  C-C motif chemokine 28
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
hsa04672  Intestinal immune network for IgA production
Network
nt06150  Cytokine-cytokine receptor interaction (viruses)
  Element
N01181  CCL5/7/11/13/15/24/26/27/28 to CCR3 signaling
N01183  CCL5/11/13/26/28 to HCMV US28 signaling
N01186  HSV1 SgG1 to CCR signaling
N01187  HSV2 SgG2 to CCR signaling
N01188  VAV CrmB to CCR signaling
N01225  CCL27/28 to CCR10 signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    56477 (CCL28)
   04061 Viral protein interaction with cytokine and cytokine receptor
    56477 (CCL28)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    56477 (CCL28)
   04062 Chemokine signaling pathway
    56477 (CCL28)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    56477 (CCL28)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   56477 (CCL28)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 56477
NCBI-ProteinID: NP_001288802
OMIM: 605240
HGNC: 17700
Ensembl: ENSG00000151882
Pharos: Q9NRJ3(Tbio)
UniProt: Q9NRJ3 A0N0Q3
Structure
LinkDB
Position
5:complement(43356975..43412391)
AA seq 127 aa
MQQRGLAIVALAVCAALHASEAILPIASSCCTEVSHHISRRLLERVNMCRIQRADGDCDL
AAVILHVKRRRICVSPHNHTVKQWMKVQAAKKNGKGNVCHRKKHHGKRNSNRAHQGKHET
YGHKTPY
NT seq 384 nt   +upstreamnt  +downstreamnt
atgcagcagagaggactcgccatcgtggccttggctgtctgtgcggccctacatgcctca
gaagccatacttcccattgcctccagctgttgcacggaggtttcacatcatatttccaga
aggctcctggaaagagtgaatatgtgtcgcatccagagagctgatggggattgtgacttg
gctgctgtcatccttcatgtcaagcgcagaagaatctgtgtcagcccgcacaaccatact
gttaagcagtggatgaaagtgcaagctgccaagaaaaatggtaaaggaaatgtttgccac
aggaagaaacaccatggcaagaggaacagtaacagggcacatcaggggaaacacgaaaca
tacggccataaaactccttattag

KEGG   Homo sapiens (human): 6352
Entry
6352              CDS       T01001                                 
Symbol
CCL5, D17S136E, RANTES, SCYA5, SIS-delta, SISd, TCP228, eoCP
Name
(RefSeq) C-C motif chemokine ligand 5
  KO
K12499  C-C motif chemokine 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04623  Cytosolic DNA-sensing pathway
hsa04668  TNF signaling pathway
hsa05020  Prion disease
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05131  Shigellosis
hsa05142  Chagas disease
hsa05163  Human cytomegalovirus infection
hsa05164  Influenza A
hsa05168  Herpes simplex virus 1 infection
hsa05323  Rheumatoid arthritis
hsa05417  Lipid and atherosclerosis
Network
nt06124  Chemokine signaling (viruses)
nt06150  Cytokine-cytokine receptor interaction (viruses)
nt06167  Human cytomegalovirus (HCMV)
  Element
N00406  HCMV US28 to GNA12/13-Rho signaling pathway
N00428  CCR5-GNB/G-PLCB/G-PKC signaling pathway
N00429  HCMV UL22A to CCR5-GNB/G-PLCB/G-PKC signaling pathway
N01166  CCL3/5/7/8/13/14/15/16/23 to CCR1 signaling
N01181  CCL5/7/11/13/15/24/26/27/28 to CCR3 signaling
N01182  VAV vCCI to CCR signaling
N01183  CCL5/11/13/26/28 to HCMV US28 signaling
N01184  CCL5 to HHV6 U12 signaling
N01185  CCL5/11 to HHV6 U51 signaling
N01190  CCL5/17/22 to CCR4 signaling
N01196  CCL3/4/5/8 to CCR5 signaling
Disease
H01358  Atopic dermatitis
H01360  Allergic rhinitis
H01563  HIV infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    6352 (CCL5)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6352 (CCL5)
   04061 Viral protein interaction with cytokine and cytokine receptor
    6352 (CCL5)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    6352 (CCL5)
   04621 NOD-like receptor signaling pathway
    6352 (CCL5)
   04623 Cytosolic DNA-sensing pathway
    6352 (CCL5)
   04062 Chemokine signaling pathway
    6352 (CCL5)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    6352 (CCL5)
   05168 Herpes simplex virus 1 infection
    6352 (CCL5)
   05163 Human cytomegalovirus infection
    6352 (CCL5)
  09171 Infectious disease: bacterial
   05120 Epithelial cell signaling in Helicobacter pylori infection
    6352 (CCL5)
   05131 Shigellosis
    6352 (CCL5)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    6352 (CCL5)
  09163 Immune disease
   05323 Rheumatoid arthritis
    6352 (CCL5)
  09164 Neurodegenerative disease
   05020 Prion disease
    6352 (CCL5)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    6352 (CCL5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    6352 (CCL5)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    6352 (CCL5)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   6352 (CCL5)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Heparin
  Chemokines
   6352 (CCL5)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 6352
NCBI-ProteinID: NP_002976
OMIM: 187011
HGNC: 10632
Ensembl: ENSG00000271503
Pharos: P13501(Tchem)
UniProt: P13501 D0EI67
Structure
LinkDB
Position
17:complement(35871491..35880360)
AA seq 91 aa
MKVSAAALAVILIATALCAPASASPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNP
AVVFVTRKNRQVCANPEKKWVREYINSLEMS
NT seq 276 nt   +upstreamnt  +downstreamnt
atgaaggtctccgcggcagccctcgctgtcatcctcattgctactgccctctgcgctcct
gcatctgcctccccatattcctcggacaccacaccctgctgctttgcctacattgcccgc
ccactgccccgtgcccacatcaaggagtatttctacaccagtggcaagtgctccaaccca
gcagtcgtctttgtcacccgaaagaaccgccaagtgtgtgccaacccagagaagaaatgg
gttcgggagtacatcaactctttggagatgagctag

KEGG   Homo sapiens (human): 6354
Entry
6354              CDS       T01001                                 
Symbol
CCL7, FIC, MARC, MCP-3, MCP3, NC28, SCYA6, SCYA7
Name
(RefSeq) C-C motif chemokine ligand 7
  KO
K05509  C-C motif chemokine 7
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
hsa04657  IL-17 signaling pathway
Network
nt06150  Cytokine-cytokine receptor interaction (viruses)
  Element
N01166  CCL3/5/7/8/13/14/15/16/23 to CCR1 signaling
N01167  VAV vCCI to CCR signaling
N01168  CCL3/7 to HCMV US28 signaling
N01173  CCL2/7/8/13/27 to CCR2 signaling
N01181  CCL5/7/11/13/15/24/26/27/28 to CCR3 signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6354 (CCL7)
   04061 Viral protein interaction with cytokine and cytokine receptor
    6354 (CCL7)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    6354 (CCL7)
   04062 Chemokine signaling pathway
    6354 (CCL7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    6354 (CCL7)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   6354 (CCL7)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 6354
NCBI-ProteinID: NP_006264
OMIM: 158106
HGNC: 10634
Ensembl: ENSG00000108688
Pharos: P80098(Tbio)
UniProt: P80098
Structure
LinkDB
Position
17:34270221..34272242
AA seq 99 aa
MKASAALLCLLLTAAAFSPQGLAQPVGINTSTTCCYRFINKKIPKQRLESYRRTTSSHCP
REAVIFKTKLDKEICADPTQKWVQDFMKHLDKKTQTPKL
NT seq 300 nt   +upstreamnt  +downstreamnt
atgaaagcctctgcagcacttctgtgtctgctgctcacagcagctgctttcagcccccag
gggcttgctcagccagttgggattaatacttcaactacctgctgctacagatttatcaat
aagaaaatccctaagcagaggctggagagctacagaaggaccaccagtagccactgtccc
cgggaagctgtaatcttcaagaccaaactggacaaggagatctgtgctgaccccacacag
aagtgggtccaggactttatgaagcacctggacaagaaaacccaaactccaaagctttga

KEGG   Homo sapiens (human): 6356
Entry
6356              CDS       T01001                                 
Symbol
CCL11, SCYA11
Name
(RefSeq) C-C motif chemokine ligand 11
  KO
K16597  C-C motif chemokine 11
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
hsa04657  IL-17 signaling pathway
hsa05310  Asthma
Network
nt06150  Cytokine-cytokine receptor interaction (viruses)
  Element
N01181  CCL5/7/11/13/15/24/26/27/28 to CCR3 signaling
N01182  VAV vCCI to CCR signaling
N01183  CCL5/11/13/26/28 to HCMV US28 signaling
N01185  CCL5/11 to HHV6 U51 signaling
Disease
H00079  Asthma
H01563  HIV infection
Drug target
Lazucernon (DG03095): D11741 D11742
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6356 (CCL11)
   04061 Viral protein interaction with cytokine and cytokine receptor
    6356 (CCL11)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    6356 (CCL11)
   04062 Chemokine signaling pathway
    6356 (CCL11)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    6356 (CCL11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    6356 (CCL11)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   6356 (CCL11)
SSDB
Motif
Pfam: IL8 Tetraspanin
Other DBs
NCBI-GeneID: 6356
NCBI-ProteinID: NP_002977
OMIM: 601156
HGNC: 10610
Ensembl: ENSG00000172156
Pharos: P51671(Tbio)
UniProt: P51671 Q6I9T4
Structure
LinkDB
Position
17:34285742..34288334
AA seq 97 aa
MKVSAALLWLLLIAAAFSPQGLAGPASVPTTCCFNLANRKIPLQRLESYRRITSGKCPQK
AVIFKTKLAKDICADPKKKWVQDSMKYLDQKSPTPKP
NT seq 294 nt   +upstreamnt  +downstreamnt
atgaaggtctccgcagcacttctgtggctgctgctcatagcagctgccttcagcccccag
gggctcgctgggccagcttctgtcccaaccacctgctgctttaacctggccaataggaag
ataccccttcagcgactagagagctacaggagaatcaccagtggcaaatgtccccagaaa
gctgtgatcttcaagaccaaactggccaaggatatctgtgccgaccccaagaagaagtgg
gtgcaggattccatgaagtatctggaccaaaaatctccaactccaaagccataa

KEGG   Homo sapiens (human): 6357
Entry
6357              CDS       T01001                                 
Symbol
CCL13, CKb10, MCP-4, NCC-1, NCC1, SCYA13, SCYL1
Name
(RefSeq) C-C motif chemokine ligand 13
  KO
K16595  C-C motif chemokine 13
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
hsa04064  NF-kappa B signaling pathway
Network
nt06150  Cytokine-cytokine receptor interaction (viruses)
  Element
N01166  CCL3/5/7/8/13/14/15/16/23 to CCR1 signaling
N01173  CCL2/7/8/13/27 to CCR2 signaling
N01181  CCL5/7/11/13/15/24/26/27/28 to CCR3 signaling
N01182  VAV vCCI to CCR signaling
N01183  CCL5/11/13/26/28 to HCMV US28 signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    6357 (CCL13)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6357 (CCL13)
   04061 Viral protein interaction with cytokine and cytokine receptor
    6357 (CCL13)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    6357 (CCL13)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    6357 (CCL13)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    6357 (CCL13)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   6357 (CCL13)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Heparin
  Chemokines
   6357 (CCL13)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 6357
NCBI-ProteinID: NP_005399
OMIM: 601391
HGNC: 10611
Ensembl: ENSG00000181374
Pharos: Q99616(Tbio)
UniProt: Q99616
Structure
LinkDB
Position
17:34356480..34358610
AA seq 98 aa
MKVSAVLLCLLLMTAAFNPQGLAQPDALNVPSTCCFTFSSKKISLQRLKSYVITTSRCPQ
KAVIFRTKLGKEICADPKEKWVQNYMKHLGRKAHTLKT
NT seq 297 nt   +upstreamnt  +downstreamnt
atgaaagtctctgcagtgcttctgtgcctgctgctcatgacagcagctttcaacccccag
ggacttgctcagccagatgcactcaacgtcccatctacttgctgcttcacatttagcagt
aagaagatctccttgcagaggctgaagagctatgtgatcaccaccagcaggtgtccccag
aaggctgtcatcttcagaaccaaactgggcaaggagatctgtgctgacccaaaggagaag
tgggtccagaattatatgaaacacctgggccggaaagctcacaccctgaagacttga

KEGG   Homo sapiens (human): 6359
Entry
6359              CDS       T01001                                 
Symbol
CCL15, HCC-2, HMRP-2B, LKN-1, LKN1, MIP-1_delta, MIP-1D, MIP-5, MRP-2B, NCC-3, NCC3, SCYA15, SCYL3, SY15
Name
(RefSeq) C-C motif chemokine ligand 15
  KO
K05511  C-C motif chemokine 15/23
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
Network
nt06150  Cytokine-cytokine receptor interaction (viruses)
  Element
N01166  CCL3/5/7/8/13/14/15/16/23 to CCR1 signaling
N01181  CCL5/7/11/13/15/24/26/27/28 to CCR3 signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6359 (CCL15)
   04061 Viral protein interaction with cytokine and cytokine receptor
    6359 (CCL15)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    6359 (CCL15)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    6359 (CCL15)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   6359 (CCL15)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 6359
NCBI-ProteinID: NP_116741
OMIM: 601393
HGNC: 10613
Ensembl: ENSG00000275718
Pharos: Q16663(Tbio)
UniProt: Q16663 A0A0B4J2E2
Structure
LinkDB
Position
17:complement(35997582..36001553)
AA seq 113 aa
MKVSVAALSCLMLVAVLGSQAQFTNDAETELMMSKLPLENPVVLNSFHFAADCCTSYISQ
SIPCSLMKSYFETSSECSKPGVIFLTKKGRQVCAKPSGPGVQDCMKKLKPYSI
NT seq 342 nt   +upstreamnt  +downstreamnt
atgaaggtctccgtggctgccctctcctgcctcatgcttgttgctgtccttggatcccag
gcccagttcacaaatgatgcagagacagagttaatgatgtcaaagcttccactggaaaat
ccagtagttctgaacagctttcactttgctgctgactgctgcacctcctacatctcacaa
agcatcccgtgttcactcatgaaaagttattttgaaacgagcagcgagtgctccaagcca
ggtgtcatattcctcaccaagaaggggcggcaagtctgtgccaaacccagtggtccggga
gttcaggattgcatgaaaaagctgaagccctactcaatataa

KEGG   Homo sapiens (human): 6368
Entry
6368              CDS       T01001                                 
Symbol
CCL23, CK-BETA-8, CKb8, Ckb-8, Ckb-8-1, MIP-3, MIP3, MPIF-1, SCYA23, hmrp-2a
Name
(RefSeq) C-C motif chemokine ligand 23
  KO
K05511  C-C motif chemokine 15/23
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
Network
nt06150  Cytokine-cytokine receptor interaction (viruses)
  Element
N01166  CCL3/5/7/8/13/14/15/16/23 to CCR1 signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6368 (CCL23)
   04061 Viral protein interaction with cytokine and cytokine receptor
    6368 (CCL23)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    6368 (CCL23)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    6368 (CCL23)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   6368 (CCL23)
SSDB
Motif
Pfam: IL8 FAD_binding_2
Other DBs
NCBI-GeneID: 6368
NCBI-ProteinID: NP_665905
OMIM: 602494
HGNC: 10622
Ensembl: ENSG00000274736
Pharos: P55773(Tbio)
UniProt: P55773
Structure
LinkDB
Position
17:complement(36013058..36017972)
AA seq 120 aa
MKVSVAALSCLMLVTALGSQARVTKDAETEFMMSKLPLENPVLLDRFHATSADCCISYTP
RSIPCSLLESYFETNSECSKPGVIFLTKKGRRFCANPSDKQVQVCMRMLKLDTRIKTRKN
NT seq 363 nt   +upstreamnt  +downstreamnt
atgaaggtctccgtggctgccctctcctgcctcatgcttgttactgcccttggatcccag
gcccgggtcacaaaagatgcagagacagagttcatgatgtcaaagcttccattggaaaat
ccagtacttctggacagattccatgctactagtgctgactgctgcatctcctacacccca
cgaagcatcccgtgttcactcctggagagttactttgaaacgaacagcgagtgctccaag
ccgggtgtcatcttcctcaccaagaaggggcgacgtttctgtgccaaccccagtgataag
caagttcaggtttgcatgagaatgctgaagctggacacacggatcaagaccaggaagaat
tga

KEGG   Homo sapiens (human): 6369
Entry
6369              CDS       T01001                                 
Symbol
CCL24, Ckb-6, MPIF-2, MPIF2, SCYA24
Name
(RefSeq) C-C motif chemokine ligand 24
  KO
K21097  C-C motif chemokine 24
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
Network
nt06150  Cytokine-cytokine receptor interaction (viruses)
  Element
N01181  CCL5/7/11/13/15/24/26/27/28 to CCR3 signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6369 (CCL24)
   04061 Viral protein interaction with cytokine and cytokine receptor
    6369 (CCL24)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    6369 (CCL24)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    6369 (CCL24)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   6369 (CCL24)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 6369
NCBI-ProteinID: NP_002982
OMIM: 602495
HGNC: 10623
Ensembl: ENSG00000106178
Pharos: O00175(Tbio)
UniProt: O00175
Structure
LinkDB
Position
7:complement(75810825..75823372)
AA seq 119 aa
MAGLMTIVTSLLFLGVCAHHIIPTGSVVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLK
AGVIFTTKKGQQFCGDPKQEWVQRYMKNLDAKQKKASPRARAVAVKGPVQRYPGNQTTC
NT seq 360 nt   +upstreamnt  +downstreamnt
atggcaggcctgatgaccatagtaaccagccttctgttccttggtgtctgtgcccaccac
atcatccctacgggctctgtggtcatcccctctccctgctgcatgttctttgtttccaag
agaattcctgagaaccgagtggtcagctaccagctgtccagcaggagcacatgcctcaag
gcaggagtgatcttcaccaccaagaagggccagcagttctgtggcgaccccaagcaggag
tgggtccagaggtacatgaagaacctggacgccaagcagaagaaggcttcccctagggcc
agggcagtggctgtcaagggccctgtccagagatatcctggcaaccaaaccacctgctaa

DBGET integrated database retrieval system