KEGG   Homo sapiens (human): 10424
Entry
10424             CDS       T01001                                 
Symbol
PGRMC2, DG6, PMBP
Name
(RefSeq) progesterone receptor membrane component 2
  KO
K17278  membrane-associated progesterone receptor component
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    10424 (PGRMC2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    10424 (PGRMC2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   10424 (PGRMC2)
SSDB
Motif
Pfam: Cyt-b5
Other DBs
NCBI-GeneID: 10424
NCBI-ProteinID: NP_006311
OMIM: 607735
HGNC: 16089
Ensembl: ENSG00000164040
Pharos: O15173(Tbio)
UniProt: O15173
LinkDB
Position
4:complement(128269242..128287813)
AA seq 223 aa
MAAGDGDVKLGTLGSGSESSNDGGSESPGDAGAAAEGGGWAAAALALLTGGGEMLLNVAL
VALVLLGAYRLWVRWGRRGLGAGAGAGEESPATSLPRMKKRDFSLEQLRQYDGSRNPRIL
LAVNGKVFDVTKGSKFYGPAGPYGIFAGRDASRGLATFCLDKDALRDEYDDLSDLNAVQM
ESVREWEMQFKEKYDYVGRLLKPGEEPSEYTDEEDTKDHNKQD
NT seq 672 nt   +upstreamnt  +downstreamnt
atggcggctggtgatggggacgtgaagctaggcaccctggggagtggcagcgagagcagc
aacgacggcggcagcgagagtccaggcgacgcgggagcggcagcggaagggggaggctgg
gcggcggcggcgttggcgcttctgacggggggcggggaaatgctgctgaacgtggcgctg
gtggctctggtgctgctgggggcctaccggctgtgggtgcgctgggggcggcggggtctg
ggggccggggccggggcgggcgaggagagccccgccacctctctgcctcgcatgaagaag
cgggacttcagcttggagcagctgcgccagtacgacggctcccgcaacccgcgcatcctg
ctcgcggtcaatgggaaagtcttcgacgtgaccaaaggcagcaagttctacggcccggcg
ggtccatatggaatatttgctggtagggatgcctccagaggactggccacattttgccta
gataaagatgcacttagagatgaatatgatgatctctcagatttgaatgcagtacaaatg
gagagtgttcgagaatgggaaatgcagtttaaagaaaaatatgattatgtaggcagactc
ctaaaaccaggagaagaaccatcagaatatacagatgaagaagataccaaggatcacaat
aaacaggattga

KEGG   Homo sapiens (human): 10857
Entry
10857             CDS       T01001                                 
Symbol
PGRMC1, Dap1, HPR6.6, IZA, MPR
Name
(RefSeq) progesterone receptor membrane component 1
  KO
K17278  membrane-associated progesterone receptor component
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    10857 (PGRMC1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    10857 (PGRMC1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   10857 (PGRMC1)
SSDB
Motif
Pfam: Cyt-b5 Tr-sialidase_C
Other DBs
NCBI-GeneID: 10857
NCBI-ProteinID: NP_006658
OMIM: 300435
HGNC: 16090
Ensembl: ENSG00000101856
Pharos: O00264(Tbio)
UniProt: O00264 Q6IB11
Structure
LinkDB
Position
X:119236285..119244466
AA seq 195 aa
MAAEDVVATGADPSDLESGGLLHEIFTSPLNLLLLGLCIFLLYKIVRGDQPAASGDSDDD
EPPPLPRLKRRDFTPAELRRFDGVQDPRILMAINGKVFDVTKGRKFYGPEGPYGVFAGRD
ASRGLATFCLDKEALKDEYDDLSDLTAAQQETLSDWESQFTFKYHHVGKLLKEGEEPTVY
SDEEEPKDESARKND
NT seq 588 nt   +upstreamnt  +downstreamnt
atggctgccgaggatgtggtggcgactggcgccgacccaagcgatctggagagcggcggg
ctgctgcatgagattttcacgtcgccgctcaacctgctgctgcttggcctctgcatcttc
ctgctctacaagatcgtgcgcggggaccagccggcggccagcggcgacagcgacgacgac
gagccgccccctctgccccgcctcaagcggcgcgacttcacccccgccgagctgcggcgc
ttcgacggcgtccaggacccgcgcatactcatggccatcaacggcaaggtgttcgatgtg
accaaaggccgcaaattctacgggcccgaggggccgtatggggtctttgctggaagagat
gcatccaggggccttgccacattttgcctggataaggaagcactgaaggatgagtacgat
gacctttctgacctcactgctgcccagcaggagactctgagtgactgggagtctcagttc
actttcaagtatcatcacgtgggcaaactgctgaaggagggggaggagcccactgtgtac
tcagatgaggaagaaccaaaagatgagagtgcccggaaaaatgattaa

DBGET integrated database retrieval system