KEGG   Homo sapiens (human): 10427
Entry
10427             CDS       T01001                                 

Gene name
SEC24B, SEC24
Definition
(RefSeq) SEC24 homolog B, COPII coat complex component
  KO
K14007  protein transport protein SEC24
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
hsa05130  Pathogenic Escherichia coli infection
Network
nt06125  Membrane trafficking (bacteria)
  Element
N01289  COPII vesicle formation
N01290  Escherichia NleA to COPII vesicle formation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    10427 (SEC24B)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    10427 (SEC24B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    10427 (SEC24B)
Membrane trafficking [BR:hsa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Coat protein complex II (COP-II)
    10427 (SEC24B)
SSDB
Motif
Pfam: Sec23_trunk Sec23_helical Sec23_BS zf-Sec23_Sec24 Gelsolin Sen15
Other DBs
NCBI-GeneID: 10427
NCBI-ProteinID: NP_006314
OMIM: 607184
HGNC: 10704
Ensembl: ENSG00000138802
Vega: OTTHUMG00000161372
Pharos: O95487(Tdark)
UniProt: O95487
LinkDB
Structure
PDB: 
3EH1

Position
4q25
AA seq 1268 aa
MSAPAGSSHPAASARIPPKFGGAAVSGAAAPAGPGAGPAPHQQNGPAQNQMQVPSGYGLH
HQNYIAPSGHYSQGPGKMTSLPLDTQCGDYYSALYTVPTQNVTPNTVNQQPGAQQLYSRG
PPAPHIVGSTLGSFQGAASSASHLHTSASQPYSSFVNHYNSPAMYSASSSVASQGFPSTC
GHYAMSTVSNAAYPSVSYPSLPAGDTYGQMFTSQNAPTVRPVKDNSFSGQNTAISHPSPL
PPLPSQQHHQQQSLSGYSTLTWSSPGLPSTQDNLIRNHTGSLAVANNNPTITVADSLSCP
VMQNVQPPKSSPVVSTVLSGSSGSSSTRTPPTANHPVEPVTSVTQPSELLQQKGVQYGEY
VNNQASSAPTPLSSTSDDEEEEEEDEEAGVDSSSTTSSASPMPNSYDALEGGSYPDMLSS
SASSPAPDPAPEPDPASAPAPASAPAPVVPQPSKMAKPFGYGYPTLQPGYQNATAPLISG
VQPSNPVYSGFQQYPQQYPGVNQLSSSIGGLSLQSSPQPESLRPVNLTQERNILPMTPVW
APVPNLNADLKKLNCSPDSFRCTLTNIPQTQALLNKAKLPLGLLLHPFRDLTQLPVITSN
TIVRCRSCRTYINPFVSFIDQRRWKCNLCYRVNDVPEEFMYNPLTRSYGEPHKRPEVQNS
TVEFIASSDYMLRPPQPAVYLFVLDVSHNAVEAGYLTILCQSLLENLDKLPGDSRTRIGF
MTFDSTIHFYNLQEGLSQPQMLIVSDIDDVFLPTPDSLLVNLYESKELIKDLLNALPNMF
TNTRETHSALGPALQAAFKLMSPTGGRVSVFQTQLPSLGAGLLQSREDPNQRSSTKVVQH
LGPATDFYKKLALDCSGQQTAVDLFLLSSQYSDLASLACMSKYSAGCIYYYPSFHYTHNP
SQAEKLQKDLKRYLTRKIGFEAVMRIRCTKGLSMHTFHGNFFVRSTDLLSLANINPDAGF
AVQLSIEESLTDTSLVCFQTALLYTSSKGERRIRVHTLCLPVVSSLADVYAGVDVQAAIC
LLANMAVDRSVSSSLSDARDALVNAVVDSLSAYGSTVSNLQHSALMAPSSLKLFPLYVLA
LLKQKAFRTGTSTRLDDRVYAMCQIKSQPLVHLMKMIHPNLYRIDRLTDEGAVHVNDRIV
PQPPLQKLSAEKLTREGAFLMDCGSVFYIWVGKGCDNNFIEDVLGYTNFASIPQKMTHLP
ELDTLSSERARSFITWLRDSRPLSPILHIVKDESPAKAEFFQHLIEDRTEAAFSYYEFLL
HVQQQICK
NT seq 3807 nt   +upstreamnt  +downstreamnt
atgtcggcccccgccgggtcctctcacccggccgccagcgcccggatcccgcccaagttc
ggcggagcggccgtctcaggagccgcagcgcccgcgggcccgggtgcgggcccggcgccg
caccagcagaacggtccagcccagaatcaaatgcaggttccatctggatatggattgcat
catcaaaactatattgctccctcaggacattactctcaaggacctgggaaaatgacctca
ttgccattggatacccagtgtggtgattactactctgctctctatacagtaccaacacaa
aatgtgactcctaacacagtgaaccagcaaccaggagcacagcagttgtacagcaggggt
cctcctgcccctcatattgtgggatccactctaggatctttccaaggtgctgcatcgtca
gcatcccatttgcatacgagtgcctcccaaccatactcctcttttgtgaatcactacaat
agtccagccatgtactctgccagctcttctgttgcgtctcagggatttccctctacttgt
ggtcattatgctatgtcaactgtttctaatgccgcgtatcctagtgtttcatatccctct
ctgcctgctggtgatacatatgggcaaatgtttacctcacagaatgctccgactgttagg
ccagttaaagataattcattctctggtcaaaatacagctatcagccatccatcgccactt
ccacctctaccatcacaacagcaccaccagcagcaaagtctttcaggatacagtactcta
acgtggtcatctccaggccttccatcgactcaagacaatctcatccgaaaccacacagga
tccctggctgtagcgaacaacaacccaaccattactgttgcagattctttatcctgtcct
gttatgcaaaatgttcagcctcccaagtccagcccagtggtatccactgttttatcagga
tcctcaggatcctcatcaacaagaacacctcccactgcaaatcacccagttgagcctgtg
acctcagttacacagccatcagagctattacaacaaaaaggcgtgcagtatggtgaatat
gttaataaccaagctagctccgcaccaactcccttgtcatcaacttccgatgatgaggaa
gaggaggaggaggatgaggaagcaggtgttgacagctcttctaccacaagcagtgcttct
ccaatgcccaacagttatgatgccctggaaggaggcagttacccagatatgctttcttca
tcagcaagcagtcctgctcctgatcccgcccctgaacctgatcctgcttctgctccagct
ccagcttcagctccagctcctgtcgtccctcagccttcaaaaatggctaagccttttggc
tatggctatccaacacttcagcctggttatcagaatgctacagcaccacttatttctgga
gtacagcccagtaacccggtatattctggattccagcagtatcctcaacagtatcctggt
gtgaaccagctatcctccagtataggaggattgagtcttcagagttctccacaaccagaa
agcctgagacctgtaaaccttactcaggagaggaatattttacctatgactcctgtttgg
gctcctgtacctaacttgaatgcagacctcaaaaaattaaactgtagcccagattcattt
cggtgtactttgacaaatattccacagacacaggctttactgaataaagctaagcttcct
ttaggattgttgttacatcccttcagagacctaacgcaattaccagtgataacatcaaat
accattgtgaggtgccgatcctgtcgaacgtatattaacccctttgtatccttcattgat
caacgtagatggaaatgcaatttgtgctatagagtaaacgatgttcctgaagaatttatg
tataacccccttacccgatcttatggagagcctcataaacgaccagaagttcagaattca
actgtggagttcattgcttcttcagattacatgctgcgtcctcctcaacctgcagtttac
ttgtttgttttagatgtgtctcataatgcagtggaagctggatatttgacaattttgtgc
cagtcactcctagaaaatctagacaagcttcctggagattcacgaacaagaataggattc
atgacctttgatagcactattcatttctacaatttacaagaaggattatcacagcctcaa
atgttgattgtgtctgatatagatgatgtttttctacctacaccggatagtttacttgtg
aatctatatgaaagtaaagagcttataaaagacttactgaatgcattaccaaacatgttc
accaatacaagagaaacacacagtgcccttggtcctgcacttcaggctgcctttaaatta
atgtctccaacaggtggccgtgtgtctgtatttcagacacagttaccttccttgggtgca
ggacttctgcaatccagagaagatcctaatcagagatcaagtacaaaggtggtacaacat
cttggccctgcaactgatttttataagaaacttgcattagattgctcgggacagcaaact
gcagtggatttgttccttttaagttcacagtattctgatcttgcttctctagcttgcatg
tccaagtattctgcagggtgcatctattattatccatcattccactatactcacaatcct
tcacaagcagaaaagttacaaaaagacctaaaacggtatctcacaagaaaaattgggttt
gaagctgttatgagaataaggtgtactaaaggtctttcaatgcacacttttcacggtaac
ttctttgtccgttctactgatttgttatcccttgccaacatcaatcctgatgctggattt
gcggtgcagttgtcaattgaagaaagtttaacagatacttccttagtatgttttcaaaca
gccctattatatacatcaagcaaaggtgagcggagaattagagtacatacactttgtttg
ccagtggtaagttcactagcagatgtatatgcgggagtggatgtacaagctgccatctgc
cttctggcaaacatggctgtggatcggtccgtttcatcaagtctgtcagatgcaagagat
gccttagtgaatgctgtagtggactcattgtctgcatatggctcaactgtctcaaattta
cagcactctgcattgatggcgcccagctccctcaagttgtttcctctctatgttttggcc
cttctcaaacagaaagcatttagaacgggtacaagcacacggctggatgatcgtgtatat
gccatgtgtcagataaagtctcagccacttgttcatctaatgaaaatgattcatcccaac
ttatacaggatagacagattgacagatgagggtgcagtacatgttaatgacaggattgta
ccacagccacctcttcaaaaattgtctgcagagaagctgacaagagaaggtgctttcctt
atggactgtggctctgttttttacatttgggttgggaaaggctgtgacaataacttcata
gaggatgtgcttggatatactaattttgcatcaataccacagaaaatgacacatcttcca
gagctagatacactttcatcagaaagagccagatccttcataacttggcttagagacagc
agaccattaagtccaatccttcacatagtaaaagatgagagtcctgccaaagcagaattt
tttcagcatttgattgaagaccggacagaggctgcattttcttactatgaatttttgctt
catgttcagcagcagatttgtaagtga

KEGG   Homo sapiens (human): 10802
Entry
10802             CDS       T01001                                 

Gene name
SEC24A
Definition
(RefSeq) SEC24 homolog A, COPII coat complex component
  KO
K14007  protein transport protein SEC24
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
hsa05130  Pathogenic Escherichia coli infection
Network
nt06125  Membrane trafficking (bacteria)
  Element
N01289  COPII vesicle formation
N01290  Escherichia NleA to COPII vesicle formation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    10802 (SEC24A)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    10802 (SEC24A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    10802 (SEC24A)
Membrane trafficking [BR:hsa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Coat protein complex II (COP-II)
    10802 (SEC24A)
SSDB
Motif
Pfam: Sec23_trunk Sec23_helical Sec23_BS zf-Sec23_Sec24 Gelsolin
Other DBs
NCBI-GeneID: 10802
NCBI-ProteinID: NP_068817
OMIM: 607183
HGNC: 10703
Ensembl: ENSG00000113615
Vega: OTTHUMG00000163064
Pharos: O95486(Tdark)
UniProt: O95486 B4E205
LinkDB
Structure
PDB: 

Position
5q31.1
AA seq 1093 aa
MSQPGIPASGGAPASLQAQNGAALASGSPYTNGPVQNALLSSQESVSQGYNFQLPGSYPH
PIPAKTLNPVSGQSNYGGSQGSGQTLNRPPVASNPVTPSLHSGPAPRMPLPASQNPATTP
MPSSSFLPEANLPPPLNWQYNYPSTASQTNHCPRASSQPTVSGNTSLTTNHQYVSSGYPS
LQNSFIKSGPSVPPLVNPPLPTTFQPGAPHGPPPAGGPPPVRALTPLTSSYRDVPQPLFN
SAVNQEGITSNTNNGSMVVHSSYDEIEGGGLLATPQLTNKNPKMSRSVGYSYPSLPPGYQ
NTTPPGATGVPPSSLNYPSGPQAFTQTPLGANHLTTSMSGLSLQPEGLRVVNLLQERNML
PSTPLKPPVPNLHEDIQKLNCNPELFRCTLTSIPQTQALLNKAKLPLGLLLHPFKDLVQL
PVVTSSTIVRCRSCRTYINPFVSFLDQRRWKCNLCYRVNDVPEEFLYNPLTRVYGEPHRR
PEVQNATIEFMAPSEYMLRPPQPPVYLFVFDVSHNAVETGYLNSVCQSLLDNLDLLPGNT
RTKIGFITFDSTIHFYGLQESLSQPQMLIVSDIEDVFIPMPENLLVNLNESKELVQDLLK
TLPQMFTKTLETQSALGPALQAAFKLMSPTGGRMSVFQTQLPTLGVGALKPREEPNHRSS
AKDIHMTPSTDFYKKLALDCSGQQVAVDLFLLSGQYSDLASLGCISRYSAGSVYYYPSYH
HQHNPVQVQKLQKELQRYLTRKIGFEAVMRIRCTKGLSIHTFHGNFFVRSTDLLSLPNVN
PDAGYAVQMSVEESLTDTQLVSFQSALLYTSSKGERRIRVHTLCLPVVSTLNDVFLGADV
QAISGLLANMAVDRSMTASLSDARDALVNAVIDSLSAYRSSVLSNQQPGLMVPFSLRLFP
LFVLALLKQKSFQTGTNARLDERIFAMCQVKNQPLVYLMLTTHPSLYRVDNLSDEGALNI
SDRTIPQPPILQLSVEKLSRDGAFLMDAGSVLMLWVGKNCTQNFLSQVLGVQNYASIPQP
MTDLPELDTPESARIIAFISWLREQRPFFPILYVIRDESPMKANFLQNMIEDRTESALSY
YEFLLHIQQQVNK
NT seq 3282 nt   +upstreamnt  +downstreamnt
atgtcccagccgggaataccggcctccggcggcgccccagccagcctccaggcccagaac
ggagccgccttggcctcggggtctccctacaccaacggtcctgtccaaaatgcattgctg
tcttcacaagagtcagtgagccaaggatacaatttccagcttccaggatcctaccctcat
ccaataccagcaaagactttgaatccagtctctggacagtctaactatggtggttctcag
ggatctgggcagactcttaatagaccacctgtggcctctaatccagtgacaccttcgctt
catagtggtcctgctccccgaatgccattacctgcttctcagaacccagctactacacca
atgccttctagtagctttcttcctgaagccaacctgccaccacctttgaattggcaatat
aactatccatccacagcctcacaaacaaaccattgtcctcgtgcatcatcccaaccaact
gtatctggaaatacaagtttaaccacaaatcatcaatatgtttcttctggatatccttca
cttcaaaatagcttcataaagtcaggtccttctgtacctcccttagtgaatccacctctg
cctacaacttttcaaccaggagctcctcatgggccccctccagctggaggcccaccccca
gtgagggccctcacgcccctgacatcatcatatagagatgtaccccagcccttatttaat
tcagctgtcaaccaagaaggtattacatcaaataccaataacggatctatggtggtccac
agtagttacgacgagattgaaggaggtggcttattggcaacaccacagcttactaacaag
aatcccaaaatgagccgaagtgttggatattcatatccctccttaccacctggttatcag
aacacaacaccacctggtgcaactggagtaccaccctcttccttgaattacccaagtggg
ccacaagcctttactcagactcccttaggtgctaatcatttaaccacaagcatgagtgga
ttaagtctacaaccagagggtctaagagttgtcaatcttcttcaagaaagaaacatgctt
ccgtcaacacctttgaagcctccagttccaaatttgcatgaagacatccagaaactcaac
tgtaacccagagttatttcgatgcacgctgactagcattcctcagacgcaggccttattg
aataaagccaaacttcctttggggctgctgcttcatcctttcaaagacttagtgcaattg
cctgtggttacctccagtacaattgtgagatgccgttcatgcaggacgtacatcaatcct
ttcgtcagctttcttgatcaaaggagatggaagtgtaacttatgttatcgagtcaatgat
gttcctgaagaattcttgtacaaccctttgaccagagtttatggagaacctcacagaaga
ccagaagttcaaaatgctactattgagtttatggctccttcagaatacatgttacgacca
cctcagcctccagtgtatctctttgtatttgatgtgtctcacaatgcagtcgaaactgga
tacttgaattcagtttgccagagtttgttagacaatctggatttgcttcctggcaacact
agaacaaaaattggcttcataacatttgacagtacaatccatttctacggtcttcaggaa
agtctctctcaacctcagatgctaatagtttcagatattgaagatgtttttatacctatg
ccagagaacttattagtaaacttaaatgaaagtaaagagctcgtgcaagatttactgaaa
actttgccacaaatgtttaccaagactctggagacccagagtgccttgggtcctgcactg
caggctgcctttaagctgatgtctccaactggtggtcgaatgtctgtctttcaaacacaa
ctcccaactcttggagtgggagccctgaaaccacgagaggaaccaaaccacaggtcatct
gctaaggatatacacatgacaccatccactgacttctataagaaattagccttggactgt
tctggtcagcaagttgctgttgacttattccttctcagtggacagtattctgatttggct
tctctgggttgtatttctcggtattcagcaggtagtgtctattactatccctcttaccat
catcagcacaacccagtccaagtacagaaattacagaaggaactacagagataccttact
cggaagattggctttgaggcagtcatgaggattcggtgcaccaaaggtctttccattcat
actttccatggaaacttctttgttaggtcaaccgacttactgtctttgcctaacgtcaac
ccagacgctgggtatgcagtacagatgtcagtggaagagagtcttactgacactcagttg
gtttcttttcagtcagcactcttgtatacatccagcaaaggcgaaagaagaattcgtgtt
catactttgtgtttgccagtagtttcgactctgaatgatgtctttcttggagctgatgtt
caagcaatttcagggttattggccaatatggctgttgacagatctatgactgccagtctg
agtgacgctcgggatgctctagtgaatgcagtcattgactccctttcagcttaccgttct
tcagtcttaagtaaccagcagcctggactcatggttcctttttctttgcggcttttccca
ctttttgtgttggctctccttaaacagaaatcattccagactgggacaaatgcacgtcta
gatgaacgcatttttgctatgtgtcaagtgaaaaaccagcccttggtttaccttatgctc
acaactcatcccagtttgtatagagttgacaatctctcagatgagggagcactcaacatc
agtgatagaaccatacctcagccccccattcttcagctttcagtggagaagctgagcaga
gatggagctttcctcatggatgcaggctctgtactgatgctttgggttggaaaaaattgt
acacagaattttctcagccaagttctaggagttcaaaactatgcatcaattccacagcct
atgacagaccttccagaacttgatacaccagaatctgccagaataatagctttcatctct
tggcttagagagcagagaccatttttcccaatactttatgtaataagggatgagagtcca
atgaaagcaaacttccttcaaaacatgatagaagacagaacagaatctgcattatcatat
tatgaattcctgttgcatatacagcaacaagtgaataaatga

KEGG   Homo sapiens (human): 9632
Entry
9632              CDS       T01001                                 

Gene name
SEC24C
Definition
(RefSeq) SEC24 homolog C, COPII coat complex component
  KO
K14007  protein transport protein SEC24
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
hsa05130  Pathogenic Escherichia coli infection
Network
nt06125  Membrane trafficking (bacteria)
  Element
N01289  COPII vesicle formation
N01290  Escherichia NleA to COPII vesicle formation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    9632 (SEC24C)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    9632 (SEC24C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    9632 (SEC24C)
Membrane trafficking [BR:hsa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Coat protein complex II (COP-II)
    9632 (SEC24C)
SSDB
Motif
Pfam: Sec23_trunk Sec23_helical Sec23_BS zf-Sec23_Sec24 Gelsolin
Other DBs
NCBI-GeneID: 9632
NCBI-ProteinID: NP_004913
OMIM: 607185
HGNC: 10705
Ensembl: ENSG00000176986
Vega: OTTHUMG00000018476
Pharos: P53992(Tbio)
UniProt: P53992 A0A024QZM6
LinkDB
Structure
PDB: 
3EH2

Position
10q22.2
AA seq 1094 aa
MNVNQSVPPVPPFGQPQPIYPGYHQSSYGGQSGSTAPAIPYGAYNGPVPGYQQTPPQGMS
RAPPSSGAPPASTAQAPCGQAAYGQFGQGDVQNGPSSTVQMQRLPGSQPFGSPLAPVGNQ
PPVLQPYGPPPTSAQVATQLSGMQISGAVAPAPPSSGLGFGPPTSLASASGSFPNSGLYG
SYPQGQAPPLSQAQGHPGIQTPQRSAPSQASSFTPPASGGPRLPSMTGPLLPGQSFGGPS
VSQPNHVSSPPQALPPGTQMTGPLGPLPPMHSPQQPGYQPQQNGSFGPARGPQSNYGGPY
PAAPTFGSQPGPPQPLPPKRLDPDAIPSPIQVIEDDRNNRGTEPFVTGVRGQVPPLVTTN
FLVKDQGNASPRYIRCTSYNIPCTSDMAKQAQVPLAAVIKPLARLPPEEASPYVVDHGES
GPLRCNRCKAYMCPFMQFIEGGRRFQCCFCSCINDVPPQYFQHLDHTGKRVDAYDRPELS
LGSYEFLATVDYCKNNKFPSPPAFIFMIDVSYNAIRTGLVRLLCEELKSLLDFLPREGGA
EESAIRVGFVTYNKVLHFYNVKSSLAQPQMMVVSDVADMFVPLLDGFLVNVNESRAVITS
LLDQIPEMFADTRETETVFVPVIQAGMEALKAAECAGKLFLFHTSLPIAEAPGKLKNRDD
RKLINTDKEKTLFQPQTGAYQTLAKECVAQGCCVDLFLFPNQYVDVATLSVVPQLTGGSV
YKYASFQVENDQERFLSDLRRDVQKVVGFDAVMRVRTSTGIRAVDFFGAFYMSNTTDVEL
AGLDGDKTVTVEFKHDDRLNEESGALLQCALLYTSCAGQRRLRIHNLALNCCTQLADLYR
NCETDTLINYMAKFAYRGVLNSPVKAVRDTLITQCAQILACYRKNCASPSSAGQLILPEC
MKLLPVYLNCVLKSDVLQPGAEVTTDDRAYVRQLVTSMDVTETNVFFYPRLLPLTKSPVE
STTEPPAVRASEERLSNGDIYLLENGLNLFLWVGASVQQGVVQSLFSVSSFSQITSGLSV
LPVLDNPLSKKVRGLIDSLRAQRSRYMKLTVVKQEDKMEMLFKHFLVEDKSLSGGASYVD
FLCHMHKEIRQLLS
NT seq 3285 nt   +upstreamnt  +downstreamnt
atgaacgtcaaccagtcagttccacctgtgccaccatttgggcagccccagcccatctac
ccagggtatcatcagtccagctatggtgggcaatcagggtccacagcccccgccattccc
tatggagcctacaatggcccagtaccaggctatcagcaaacacctccccaaggtatgtca
agagccccaccttcctcgggggcacctccagcctcaacagcacaggctccttgtggccag
gctgcatatggccagtttggccaaggagatgtacagaatgggccaagctccactgttcag
atgcaaaggctgcctgggtctcagccatttgggtccccattggcccctgtgggcaaccag
ccacctgtgcttcagccctatggccctcccccgacaagtgcacaggtggctacgcagctg
tctggaatgcagatcagcggtgctgtggccccagcccctccttcttcagggctgggcttt
ggcccaccaacatcgctggcttcagcctcaggaagtttccctaactctggtctgtatggc
tcctatcctcagggccaggctcctccccttagccaggcccaaggtcatcctgggatccag
actccccagcgatctgccccatcacaggcctccagcttcacacccccagcttcagggggt
cctcggctgccttcgatgactggtccactcctgcctggacagagttttggagggccctca
gtgagccagcccaaccatgtgtcttcacctcctcaagctctgccccctggcacccagatg
actgggcccctgggaccactgccacctatgcactccccgcagcagccaggctatcagccc
caacaaaatggttccttcggaccagcccggggccctcagtctaattatggaggcccctac
ccagcagcacccacctttggcagtcagcctgggcctcctcagccactgcctcctaagcgc
ctggaccctgatgccatcccaagccctattcaggtcattgaagatgacaggaacaaccgg
ggtacagagccatttgttactggagtacggggccaggtgccacccttagtcactaccaac
ttcctggtgaaagaccaagggaatgcaagtccccgatacatccgatgtacatcctataat
atcccttgcacatctgacatggctaagcaggctcaggtgcccctggcagcagtcatcaaa
ccgctggcaaggctgcccccagaggaggcttcaccgtatgttgtggaccatggggaatct
ggccctttgcgctgcaaccgctgcaaagcatacatgtgtcccttcatgcagttcattgaa
ggagggaggcgtttccagtgctgtttttgcagctgtatcaatgatgttcccccccagtat
tttcagcacctggatcataccggcaaacgtgtggatgcttatgaccgccctgagctatcc
ctgggctcttatgaattcttggccactgtagattactgcaagaacaataagttccccagc
cctcctgcctttatcttcatgattgacgtctcctacaatgccatcaggactggtcttgtt
aggctcctctgtgaggagctcaagtcactgttagactttctacctagggagggtggggca
gaagagtcagcaatccgcgttggctttgtcacctacaataaggtgctccacttctataat
gtgaagagctcattggcccagccacagatgatggttgtgtctgatgtggctgacatgttt
gtgccactgctggatggcttcctggtcaacgtcaatgagtctcgggcagttatcaccagc
ttattggatcagattccagaaatgtttgcagacacaagggaaacagagacagtatttgta
ccagttatccaggctggaatggaggctctgaaggctgctgagtgtgcagggaagctcttt
ctattccatacatccctgcccattgcagaggccccagggaaactgaagaacagagatgac
aggaagctgatcaatacagacaaggagaagactctgttccagcctcagacaggtgcctat
cagaccctggccaaagagtgtgtggcccaaggctgctgtgtagatctctttctcttccct
aaccagtatgtggatgtggccacactctctgttgtgccccagctcactggtggctctgtc
tacaaatatgcttcctttcaggtggagaacgaccaggagcggttcctgagtgacctgcgt
cgtgatgtccagaaggttgttggctttgatgctgtgatgcgggtccggacaagcactggt
atccgtgctgtagatttctttggagctttctacatgagcaacacgacagatgtggagctg
gctgggctagatggggacaaaacagtgactgtggagttcaagcatgacgatcggctcaat
gaagagagcggagctctcctgcagtgtgccctgctttacaccagctgtgcagggcagcgt
cggctccgcatccataatctggccctgaactgctgcacccagctggctgatctatatcga
aactgtgagactgacacgctcatcaactacatggccaagtttgcatatcggggagtcctg
aatagccctgtgaaggctgttcgtgacacgctcatcacccagtgtgcccagatcctggcc
tgttacagaaagaactgtgctagcccctcctctgcaggacagttgatccttcctgagtgc
atgaagctactcccagtttacctgaactgtgtgttgaagagtgatgtcctgcagcctgga
gctgaagtcactactgatgaccgtgcctatgtccgacagctagttacctccatggatgtg
actgagaccaatgtcttcttctaccctcggctcttacctttgacaaagtctcccgttgag
agtactaccgaaccaccagcagttcgagcctctgaagagcgtctaagcaatggggatata
tatttactggagaatgggctcaacctcttcctctgggtgggagcaagcgtccaacagggt
gttgtccagagccttttcagcgtctcctccttcagtcagatcaccagtggtttgagtgtt
ctgccagttctggataatccactgtccaagaaggttcgaggcctcattgatagcttacgg
gcacagagatcccggtacatgaagcttaccgtggtgaaacaggaagacaagatggagatg
ctgttcaagcacttcctggtggaagacaagagtctgagtgggggagcatcttatgtggac
tttctctgtcatatgcacaaggagattcggcagctactgagctaa

KEGG   Homo sapiens (human): 9871
Entry
9871              CDS       T01001                                 

Gene name
SEC24D, CLCRP2
Definition
(RefSeq) SEC24 homolog D, COPII coat complex component
  KO
K14007  protein transport protein SEC24
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
hsa05130  Pathogenic Escherichia coli infection
Network
nt06125  Membrane trafficking (bacteria)
  Element
N01289  COPII vesicle formation
N01290  Escherichia NleA to COPII vesicle formation
Disease
H01572  Cole-Carpenter syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    9871 (SEC24D)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    9871 (SEC24D)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    9871 (SEC24D)
Membrane trafficking [BR:hsa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Coat protein complex II (COP-II)
    9871 (SEC24D)
SSDB
Motif
Pfam: Sec23_trunk Sec23_helical Sec23_BS zf-Sec23_Sec24 Gelsolin GDP_Man_Dehyd
Other DBs
NCBI-GeneID: 9871
NCBI-ProteinID: NP_055637
OMIM: 607186
HGNC: 10706
Ensembl: ENSG00000150961
Vega: OTTHUMG00000132957
Pharos: O94855(Tbio)
UniProt: O94855 A8K6V0
LinkDB
Structure
PDB: 

Position
4q26
AA seq 1032 aa
MSQQGYVATPPYSQPQPGIGLSPPHYGHYGDPSHTASPTGMMKPAGPLGATATRGMLPPG
PPPPGPHQFGQNGAHATGHPPQRFPGPPPVNNVASSHAPYQPSAQSSYPGPISTSSVTQL
GSQLSAMQINSYGSGMAPPSQGPPGPLSATSLQTPPRPPQPSILQPGSQVLPPPPTTLNG
PGASPLPLPMYRPDGLSGPPPPNAQYQPPPLPGQTLGAGYPPQQANSGPQMAGAQLSYPG
GFPGGPAQMAGPPQPQKKLDPDSIPSPIQVIENDRASRGGQVYATNTRGQIPPLVTTDCM
IQDQGNASPRFIRCTTYCFPCTSDMAKQAQIPLAAVIKPFATIPSNESPLYLVNHGESGP
VRCNRCKAYMCPFMQFIEGGRRYQCGFCNCVNDVPPFYFQHLDHIGRRLDHYEKPELSLG
SYEYVATLDYCRKSKPPNPPAFIFMIDVSYSNIKNGLVKLICEELKTMLEKIPKEEQEET
SAIRVGFITYNKVLHFFNVKSNLAQPQMMVVTDVGEVFVPLLDGFLVNYQESQSVIHNLL
DQIPDMFADSNENETVFAPVIQAGMEALKAADCPGKLFIFHSSLPTAEAPGKLKNRDDKK
LVNTDKEKILFQPQTNVYDSLAKDCVAHGCSVTLFLFPSQYVDVASLGLVPQLTGGTLYK
YNNFQMHLDRQQFLNDLRNDIEKKIGFDAIMRVRTSTGFRATDFFGGILMNNTTDVEMAA
IDCDKAVTVEFKHDDKLSEDSGALIQCAVLYTTISGQRRLRIHNLGLNCSSQLADLYKSC
ETDALINFFAKSAFKAVLHQPLKVIREILVNQTAHMLACYRKNCASPSAASQLILPDSMK
VLPVYMNCLLKNCVLLSRPEISTDERAYQRQLVMTMGVADSQLFFYPQLLPIHTLDVKST
MLPAAVRCSESRLSEEGIFLLANGLHMFLWLGVSSPPELIQGIFNVPSFAHINTDMTLLP
EVGNPYSQQLRMIMGIIQQKRPYSMKLTIVKQREQPEMVFRQFLVEDKGLYGGSSYVDFL
CCVHKEICQLLN
NT seq 3099 nt   +upstreamnt  +downstreamnt
atgagtcaacaaggttacgtggctacacctccgtattctcagcctcagcctggaataggc
ctttctccacctcattatgggcactatggggatccgtcgcacacagcatctccaacaggt
atgatgaagccagcagggcctttgggggccaccgccactaggggaatgttgcctccgggt
cccccacctcctggaccccatcagtttggtcagaatggagctcatgccactggtcaccct
ccccaaagatttccaggccctccacctgtcaacaatgtggcatcctcacatgcaccatac
caaccctctgcacaatcttcttatccaggtcctatatccacttcatctgtcacccagctg
ggcagccagctcagtgctatgcaaatcaacagctatggttcaggcatggctcctccaagc
cagggaccccctggccctctgtcagccacatcattgcagactcctccacgacctccacag
ccttccattttgcagcctggatctcaagttcttccaccaccacccaccacactcaatggt
cctggtgcctcacctttgcctctaccaatgtacagaccagatgggctctctgggcctcct
cctccaaatgcccagtaccagcccccacctcttccaggccagaccttgggtgctggatat
cctccgcagcaggccaactctggtccccagatggcaggcgcacaactgtcttacccagga
ggcttccctggaggtcctgcacagatggctggtccgccacagccccagaagaagctggat
cctgactctatccctagcccaatccaggtgattgagaatgatagagccagcagaggagga
caagtttatgccaccaacaccagaggccagatccctcccctggtcactacagattgcatg
atacaagaccaaggaaatgccagtcctcgattcatccgttgtacaacatactgttttcca
tgcacgtcagatatggctaagcaagctcagattccattagctgctgtcatcaagcccttt
gccaccattccttcaaatgagagtcccctttacttggtaaatcacggcgagagtggacca
gtcagatgcaacaggtgcaaggcctacatgtgcccatttatgcagttcatcgaaggagga
aggagatatcagtgtggattttgcaactgtgtgaatgatgttccaccattctatttccaa
catctggaccacattggaagaagactggaccactatgagaaaccagagttatctctagga
tcttatgaatatgttgccactttggattattgcagaaagagtaagcctcccaacccacca
gcctttatcttcatgattgatgtttcatatagtaacataaagaatggacttgtcaagctc
atatgtgaagaactgaagaccatgctggaaaaaattccaaaggaagagcaagaagagacg
tctgcaattcgagtgggttttatcacatataacaaagttctccatttctttaatgtgaag
agtaatctggcccagcctcagatgatggtggtgactgatgttggagaagtctttgttcct
ttgttggatggtttccttgtcaactatcaagaatcccaatctgtgattcataatttgttg
gaccagattccagacatgtttgcagactctaatgaaaatgagactgtctttgctcctgtc
atccaggctggcatggaagcactaaaggcagcagactgtcctgggaagctgttcatcttc
cattcttccttgccaactgctgaagcaccagggaagctcaaaaacagagatgacaaaaaa
ctggttaatacagacaaagagaagatacttttccagccccaaacaaatgtctatgactca
ttggccaaggactgcgtggctcacggctgctctgtgacactcttcctctttcctagtcag
tatgtggacgtggcctcgctggggctggttcctcagctcactggaggaaccctttacaaa
tacaacaatttccagatgcacttggatagacaacaatttttgaacgacctcagaaatgat
attgaaaagaaaataggctttgatgctattatgagggttcgtaccagcacaggtttcaga
gccactgatttctttggtggaatcttgatgaacaacaccaccgatgtagaaatggctgcc
atcgattgtgacaaggcagtgaccgtggagttcaagcacgatgacaaactcagtgaagac
agtggagccttaatccagtgtgctgtgctttacacgacaatcagtggtcaaagaagactt
cggattcacaatcttggcttaaactgcagctctcagctagctgatctttataagagctgt
gagacagatgctcttatcaacttctttgccaagtcagcttttaaagcagttctccaccag
cctttgaaggtcatccgggaaattctagttaatcagactgcccatatgttggcatgttac
cggaagaattgtgcaagtccttctgcagcaagccagcttattctaccagattccatgaaa
gtattgccagtgtacatgaattgcttgttgaaaaactgtgtactactcagcagaccagag
atctcaactgatgaacgagcataccagagacagctggtcatgaccatgggtgtggctgac
tctcagcttttcttctacccacaacttctgcccatacacacgttagatgtcaagagtaca
atgttacctgctgccgttcgttgctctgagtcccgtctttcagaagaaggaatattctta
ctggctaatggtctacacatgttcctgtggttgggagtaagcagcccaccagaactgatc
caaggaatatttaatgtgccatcttttgcacatatcaacacagatatgacattgctgcct
gaagtgggaaacccatactctcaacaactcagaatgataatgggtattatccaacaaaag
aggccatattcaatgaagctcacaattgtaaagcagcgagaacaaccagaaatggttttc
cgacagttcctggtagaagacaaaggactttacggaggctcttcttatgtggatttcctt
tgttgtgttcacaaggagatctgtcagctgcttaattaa

DBGET integrated database retrieval system