KEGG   Homo sapiens (human): 10477
Entry
10477             CDS       T01001                                 
Symbol
UBE2E3, UBCH9, UbcM2
Name
(RefSeq) ubiquitin conjugating enzyme E2 E3
  KO
K20217  ubiquitin-conjugating enzyme E2 E [EC:2.3.2.23]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    10477 (UBE2E3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    10477 (UBE2E3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     10477 (UBE2E3)
Ubiquitin system [BR:hsa04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   10477 (UBE2E3)
SSDB
Motif
Pfam: UQ_con RWD UEV
Other DBs
NCBI-GeneID: 10477
NCBI-ProteinID: NP_001265483
OMIM: 604151
HGNC: 12479
Ensembl: ENSG00000170035
Pharos: Q969T4(Tbio)
UniProt: Q969T4
LinkDB
Position
2:180980360..181063425
AA seq 207 aa
MSSDRQRSDDESPSTSSGSSDADQRDPAAPEPEEQEERKPSATQQKKNTKLSSKTTAKLS
TSAKRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSSDY
PFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLV
GSIATQYLTNRAEHDRIARQWTKRYAT
NT seq 624 nt   +upstreamnt  +downstreamnt
atgtccagtgataggcaaaggtccgatgatgagagccccagcaccagcagtggcagttca
gatgcggaccagcgagacccagccgctccagagcctgaagaacaagaggaaagaaaacct
tctgccacccagcagaagaaaaacaccaaactctctagcaaaaccactgctaagttatcc
actagtgctaaaagaattcagaaggagctagctgaaataacccttgatcctcctcctaat
tgcagtgctgggcctaaaggagataacatttatgaatggagatcaactatacttggtcca
ccgggttctgtatatgaaggtggtgtgttttttctggatatcacattttcatcagattat
ccatttaagccaccaaaggttactttccgcaccagaatctatcactgcaacatcaacagt
cagggagtcatctgtctggacatccttaaagacaactggagtcccgctttgactatttca
aaggttttgctgtctatttgttcccttttgacagactgcaaccctgcggatcctctggtt
ggaagcatagccactcagtatttgaccaacagagcagaacacgacaggatagccagacag
tggaccaagagatacgcaacataa

KEGG   Homo sapiens (human): 7324
Entry
7324              CDS       T01001                                 
Symbol
UBE2E1, UBCH6
Name
(RefSeq) ubiquitin conjugating enzyme E2 E1
  KO
K20217  ubiquitin-conjugating enzyme E2 E [EC:2.3.2.23]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    7324 (UBE2E1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    7324 (UBE2E1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     7324 (UBE2E1)
Ubiquitin system [BR:hsa04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   7324 (UBE2E1)
SSDB
Motif
Pfam: UQ_con RWD SR-25
Other DBs
NCBI-GeneID: 7324
NCBI-ProteinID: NP_003332
OMIM: 602916
HGNC: 12477
Ensembl: ENSG00000170142
Pharos: P51965(Tbio)
UniProt: P51965 A0A024R2K3
Structure
LinkDB
Position
3:23805955..23891640
AA seq 193 aa
MSDDDSRASTSSSSSSSSNQQTEKETNTPKKKESKVSMSKNSKLLSTSAKRIQKELADIT
LDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFTPEYPFKPPKVTFRTRIY
HCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYMTNRAEH
DRMARQWTKRYAT
NT seq 582 nt   +upstreamnt  +downstreamnt
atgtcggatgacgattcgagggccagcaccagctcctcctcatcttcgtcttccaaccag
caaaccgagaaagaaacaaacacccccaagaagaaggagagtaaagtcagcatgagcaaa
aactccaaactcctctccaccagcgccaagagaattcagaaggagctggcggacatcact
ttagaccctccacctaattgcagtgctggtcccaaaggcgataacatctatgaatggaga
tcaaccattctagggcctccaggatccgtgtatgagggtggtgtattctttctcgatatc
acttttacaccagaatatcccttcaagcctccaaaggttacatttcggacaagaatctat
cattgtaatattaacagtcaaggtgttatttgcttggacatattgaaagataattggagt
ccagcactaaccatttctaaagtcctcctttctatctgctcacttcttacagactgtaat
cctgccgaccccttggtgggaagtattgccactcagtatatgaccaacagagcagaacat
gacagaatggccagacagtggaccaagagatacgctacataa

KEGG   Homo sapiens (human): 7325
Entry
7325              CDS       T01001                                 
Symbol
UBE2E2, UBCH8
Name
(RefSeq) ubiquitin conjugating enzyme E2 E2
  KO
K20217  ubiquitin-conjugating enzyme E2 E [EC:2.3.2.23]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    7325 (UBE2E2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    7325 (UBE2E2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     7325 (UBE2E2)
Ubiquitin system [BR:hsa04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   7325 (UBE2E2)
SSDB
Motif
Pfam: UQ_con RWD
Other DBs
NCBI-GeneID: 7325
NCBI-ProteinID: NP_689866
OMIM: 602163
HGNC: 12478
Ensembl: ENSG00000182247
Pharos: Q96LR5(Tbio)
UniProt: Q96LR5
Structure
LinkDB
Position
3:23203098..23591925
AA seq 201 aa
MSTEAQRVDDSPSTSGGSSDGDQRESVQQEPEREQVQPKKKEGKISSKTAAKLSTSAKRI
QKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSPDYPFKPPK
VTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQ
YMTNRAEHDRMARQWTKRYAT
NT seq 606 nt   +upstreamnt  +downstreamnt
atgtccactgaggcacaaagagttgatgacagtccaagcactagtggaggaagttccgat
ggagatcaacgtgaaagtgttcagcaagaaccagaaagagaacaagttcagcccaagaaa
aaggagggaaaaatatccagcaaaaccgctgctaaattgtcaactagtgctaaaagaatt
cagaaggaacttgcagaaatcacattggaccctcctcccaactgtagtgctggacccaaa
ggagacaacatttatgaatggaggtcaactatattgggacccccaggatctgtctatgaa
ggaggggtgttctttcttgacattaccttttcaccagactatccgtttaaaccccctaag
gttaccttccgaacaagaatctatcactgtaatattaacagccaaggtgtgatctgtctg
gacatcttaaaggacaactggagtccggctttaactatttctaaagttctcctctccatc
tgctcacttcttacagattgcaaccctgctgaccctctggtgggcagcatcgccacacag
tacatgaccaacagagcagagcatgaccggatggccagacagtggaccaagcggtacgcc
acatag

DBGET integrated database retrieval system