KEGG   Homo sapiens (human): 10479
Entry
10479             CDS       T01001                                 

Gene name
SLC9A6, MRSA, NHE6
Definition
(RefSeq) solute carrier family 9 member A6
  KO
K12041  solute carrier family 9 (sodium/hydrogen exchanger), member 6/7
Organism
hsa  Homo sapiens (human)
Pathway
hsa04260  Cardiac muscle contraction
Disease
H01914  Christianson syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    10479 (SLC9A6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    10479 (SLC9A6)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC9: Na+/H+ exchanger
   10479 (SLC9A6)
SSDB
Motif
Pfam: Na_H_Exchanger Reo_sigmaC Stevor
Other DBs
NCBI-GeneID: 10479
NCBI-ProteinID: NP_006350
OMIM: 300231
HGNC: 11079
Ensembl: ENSG00000198689
Vega: OTTHUMG00000022498
Pharos: Q92581(Tbio)
UniProt: Q92581
LinkDB
Position
Xq26.3
AA seq 669 aa
MARRGWRRAPLRRGVGSSPRARRLMRPLWLLLAVGVFDWAGASDGGGGEARAMDEEIVSE
KQAEESHRQDSANLLIFILLLTLTILTIWLFKHRRARFLHETGLAMIYGLLVGLVLRYGI
HVPSDVNNVTLSCEVQSSPTTLLVTFDPEVFFNILLPPIIFYAGYSLKRRHFFRNLGSIL
AYAFLGTAISCFVIGSIMYGCVTLMKVTGQLAGDFYFTDCLLFGAIVSATDPVTVLAIFH
ELQVDVELYALLFGESVLNDAVAIVLSSSIVAYQPAGDNSHTFDVTAMFKSIGIFLGIFS
GSFAMGAATGVVTALVTKFTKLREFQLLETGLFFLMSWSTFLLAEAWGFTGVVAVLFCGI
TQAHYTYNNLSTESQHRTKQLFELLNFLAENFIFSYMGLTLFTFQNHVFNPTFVVGAFVA
IFLGRAANIYPLSLLLNLGRRSKIGSNFQHMMMFAGLRGAMAFALAIRDTATYARQMMFS
TTLLIVFFTVWVFGGGTTAMLSCLHIRVGVDSDQEHLGVPENERRTTKAESAWLFRMWYN
FDHNYLKPLLTHSGPPLTTTLPACCGPIARCLTSPQAYENQEQLKDDDSDLILNDGDISL
TYGDSTVNTEPATSSAPRRFMGNSSEDALDRELAFGDHELVIRGTRLVLPMDDSEPPLNL
LDNTRHGPA
NT seq 2010 nt   +upstreamnt  +downstreamnt
atggctcggcgcggctggcggcgggcacccctccgccgtggcgtcggcagcagtccccga
gcccgcaggctcatgcggcccctttggttgctcctcgcagtgggcgtctttgactgggca
ggggcttcggacggcggcggcggagaggctagagccatggacgaggagatcgtgtccgag
aagcaagccgaggagagccaccggcaggacagcgccaacctgctcatcttcatcctgctg
ctcaccctcaccattctcacaatctggctcttcaagcaccgccgggcccgcttcctgcac
gaaaccggcctggctatgatttatggtcttttggtgggccttgtgcttcggtatggcatt
catgttccgagtgatgtaaataatgtgaccctgagctgtgaagtgcagtcaagtccaact
accttactggttacttttgatccagaagtatttttcaacatattacttcctcctatcata
ttttatgcaggttatagcctgaaaaggagacatttttttcgaaatcttgggtctatccta
gcatacgcttttcttggaacagcaatttcttgtttcgttattgggtcaataatgtatggc
tgtgtaacgctgatgaaggtaacgggacaacttgcaggagatttttactttacagattgc
ctactgtttggtgccattgtatcagcaactgatccagtgactgttcttgctatattccac
gagcttcaagttgatgttgaactctatgcacttctttttggtgaaagtgtcctcaatgat
gctgttgccatagtgctgtcctcctcaatagtggcataccagccagctggagacaacagt
cacacctttgatgtcacagcgatgttcaagtctattgggatcttccttggaatcttcagt
ggatcttttgcaatgggtgctgctactggagtggtgacagctttagtgacaaagttcacc
aaattacgggagttccagttgttggagacaggcctgttcttcttgatgtcctggagtacc
ttcctcttggctgaagcatggggcttcacaggtgtagttgcagtattgttttgtggcatc
acacaagcacattatacgtataataatttgtccacggagtctcagcatagaactaaacag
ttgtttgagcttctcaatttcttggcagagaatttcatcttctcctacatggggctgaca
ctgttcaccttccagaaccatgtctttaacccaacatttgtagtaggagcatttgttgct
attttcttgggaagagctgccaatatttaccccttgtccctcttacttaatttgggtaga
agaagtaagattggatcaaattttcaacacatgatgatgtttgctggccttcgtggtgca
atggcatttgccttggccattcgagatactgccacttatgcacggcaaatgatgttcagc
accacgcttctgattgtgttttttaccgtgtgggtatttggtggtggcaccactgcaatg
ctgtcatgcttgcatatcagggttggtgttgattcagaccaagaacacttgggtgttcct
gaaaatgaaaggagaactaccaaagcagagagtgcttggcttttccggatgtggtacaac
tttgatcataactatctgaagcctctgctgacccacagcgggcctccgctgacaacaaca
ctccctgcctgctgtggacccatcgccaggtgcctcaccagcccccaggcttacgaaaac
caggaacagttgaaagatgatgattctgatcttattctcaatgatggtgacatcagtttg
acatatggagattctactgtgaacactgaaccggccacatccagcgccccaaggagattt
atgggaaacagttctgaagatgccttggatcgggagcttgcatttggggaccatgaactg
gtcattcgaggaacacgcctggttcttccaatggatgattctgaacccccgctaaatttg
ttagataatacgagacatggtccagcctaa

KEGG   Homo sapiens (human): 84679
Entry
84679             CDS       T01001                                 

Gene name
SLC9A7, MRX108, NHE-7, NHE7, SLC9A6
Definition
(RefSeq) solute carrier family 9 member A7
  KO
K12041  solute carrier family 9 (sodium/hydrogen exchanger), member 6/7
Organism
hsa  Homo sapiens (human)
Pathway
hsa04260  Cardiac muscle contraction
Disease
H00480  X-linked mental retardation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    84679 (SLC9A7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    84679 (SLC9A7)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC9: Na+/H+ exchanger
   84679 (SLC9A7)
SSDB
Motif
Pfam: Na_H_Exchanger
Other DBs
NCBI-GeneID: 84679
NCBI-ProteinID: NP_115980
OMIM: 300368
HGNC: 17123
Ensembl: ENSG00000065923
Vega: OTTHUMG00000021428
Pharos: Q96T83(Tbio)
UniProt: Q96T83 A0A024R176
LinkDB
Position
Xp11.3
AA seq 725 aa
MEPGDAARPGSGRATGAPPPRLLLLPLLLGWGLRVAAAASASSSGAAAEDSSAMEELATE
KEAEESHRQDSVSLLTFILLLTLTILTIWLFKHRRVRFLHETGLAMIYGLIVGVILRYGT
PATSGRDKSLSCTQEDRAFSTLLVNVSGKFFEYTLKGEISPGKINSVEQNDMLRKVTFDP
EVFFNILLPPIIFHAGYSLKKRHFFRNLGSILAYAFLGTAVSCFIIGNLMYGVVKLMKIM
GQLSDKFYYTDCLFFGAIISATDPVTVLAIFNELHADVDLYALLFGESVLNDAVAIVLSS
SIVAYQPAGLNTHAFDAAAFFKSVGIFLGIFSGSFTMGAVTGVNANVTKFTKLHCFPLLE
TALFFLMSWSTFLLAEACGFTGVVAVLFCGITQAHYTYNNLSVESRSRTKQLFEVLHFLA
ENFIFSYMGLALFTFQKHVFSPIFIIGAFVAIFLGRAAHIYPLSFFLNLGRRHKIGWNFQ
HMMMFSGLRGAMAFALAIRDTASYARQMMFTTTLLIVFFTVWIIGGGTTPMLSWLNIRVG
VEEPSEEDQNEHHWQYFRVGVDPDQDPPPNNDSFQVLQGDGPDSARGNRTKQESAWIFRL
WYSFDHNYLKPILTHSGPPLTTTLPAWCGLLARCLTSPQVYDNQEPLREEDSDFILTEGD
LTLTYGDSTVTANGSSSSHTASTSLEGSRRTKSSSEEVLERDLGMGDQKVSSRGTRLVFP
LEDNA
NT seq 2178 nt   +upstreamnt  +downstreamnt
atggagcctggtgacgcggcgcgccctggctcgggtcgggctaccggggcgccgccgccg
cggctgctgctgctgccgctgctgctgggttgggggctgcgagtcgcggccgcggcctcg
gcctcctcctctggggcggcggcggaggacagcagcgccatggaggagctcgctactgag
aaggaggcggaggagagccaccggcaagacagcgtgagcctgctcaccttcatcctgctg
ctcacgctcaccatcctcaccatctggctcttcaagcaccgccgggtgcgctttctgcac
gagaccgggctggccatgatctatgggctcatcgttggggtgatcctgaggtatggtacc
cctgctaccagtggccgtgacaaatcactcagctgcactcaggaagacagggccttcagt
accttattagtgaatgtcagcggaaagttcttcgaatacactctgaaaggagaaatcagt
cctggcaagatcaacagcgtagagcagaatgatatgctacggaaggtaacattcgatcca
gaagtatttttcaacattcttctgcctccaattatttttcatgctggatacagcttaaag
aagagacactttttcagaaatcttggatctatactggcctatgccttcttggggactgct
gtttcatgcttcattattggaaatctcatgtatggtgtggtgaagctcatgaagattatg
ggacagctctcagataaattttactacacagattgtctcttttttggagcaatcatctct
gccactgacccagtgactgtgctggcgatatttaatgaattgcatgcagacgtggatctt
tacgcacttctttttggagagagcgtcctaaatgatgctgttgccattgtactgtcctcg
tctattgttgcctaccagccagcgggactgaacactcacgcctttgatgctgctgccttt
tttaagtcagttggcatttttctaggtatatttagtggctcttttaccatgggagctgtg
actggtgttaatgccaacgtgactaagtttaccaaactgcactgcttccccctgctggag
acggcgctgttcttcctcatgtcctggagcacgtttctcttggcagaagcctgcggattt
acaggtgttgtagctgtccttttctgtggaatcacacaagctcattacacctacaacaat
ctgtcggtggaatcaagaagtcgaaccaagcagctctttgaggtgttacatttcctggca
gagaacttcatcttctcctacatgggcctggcactgtttaccttccagaagcacgttttc
agccccattttcatcatcggagcttttgttgccatcttcctgggcagagccgcgcacatc
tacccgctctccttcttcctcaacttgggcagaaggcataagattggctggaattttcaa
cacatgatgatgttttcaggcctcaggggagcaatggcatttgcgttggccatccgtgac
acggcatcctatgctcgccagatgatgttcacgaccacccttctcattgtgttcttcact
gtctggatcattggaggaggcacgacacccatgttgtcatggcttaacatcagagttggc
gtcgaggagccctccgaagaggaccagaatgaacaccactggcagtacttcagagttggt
gttgaccccgatcaagacccaccacccaacaacgacagctttcaagtcttacaaggggac
ggcccagattctgccagaggaaaccggacaaaacaggagagcgcatggatattcaggctg
tggtacagctttgatcacaattacctgaagcccatcctcacacacagtggtcccccacta
accaccacgctccccgcctggtgtggcttactagctcgatgtctgaccagtccccaggtg
tacgataaccaagagccactgagagaggaagactctgatttcatcctgaccgaaggcgac
ctgacattgacctacggggacagcacagtgactgcaaatggctcctcaagttcgcacacc
gcctccacgagtctggagggcagccggagaacgaagagcagctcggaggaagtgctggag
cgagacctgggaatgggagaccagaaggtttcgagccggggcacccgcctagtgtttccc
ctggaagataatgcttga

DBGET integrated database retrieval system