KEGG   Homo sapiens (human): 10533
Entry
10533             CDS       T01001                                 
Symbol
ATG7, APG7-LIKE, APG7L, GSA7, SCAR31
Name
(RefSeq) autophagy related 7
  KO
K08337  ubiquitin-like modifier-activating enzyme ATG7
Organism
hsa  Homo sapiens (human)
Pathway
hsa04136  Autophagy - other
hsa04140  Autophagy - animal
hsa04216  Ferroptosis
hsa04613  Neutrophil extracellular trap formation
Network
nt06128  Autophagy (viruses and bacteria)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06228  Autophagy
  Element
N00156  Autophagy-vesicle elongation
Disease
H01891  Autosomal recessive spinocerebellar ataxias
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    10533 (ATG7)
   04136 Autophagy - other
    10533 (ATG7)
  09143 Cell growth and death
   04216 Ferroptosis
    10533 (ATG7)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    10533 (ATG7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    10533 (ATG7)
   04121 Ubiquitin system [BR:hsa04121]
    10533 (ATG7)
   03029 Mitochondrial biogenesis [BR:hsa03029]
    10533 (ATG7)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    10533 (ATG7)
   Atg8 conjugation proteins
    10533 (ATG7)
Ubiquitin system [BR:hsa04121]
 Ubiquitin-activating enzymes (E1)
  UBL-activating enzymes
   10533 (ATG7)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    10533 (ATG7)
SSDB
Motif
Pfam: ATG7_N ThiF Shikimate_DH
Other DBs
NCBI-GeneID: 10533
NCBI-ProteinID: NP_006386
OMIM: 608760
HGNC: 16935
Ensembl: ENSG00000197548
Pharos: O95352(Tbio)
UniProt: O95352 B3KQM6
LinkDB
Position
3:11272397..11576353
AA seq 703 aa
MAAATGDPGLSKLQFAPFSSALDVGFWHELTQKKLNEYRLDEAPKDIKGYYYNGDSAGLP
ARLTLEFSAFDMSAPTPARCCPAIGTLYNTNTLESFKTADKKLLLEQAANEIWESIKSGT
ALENPVLLNKFLLLTFADLKKYHFYYWFCYPALCLPESLPLIQGPVGLDQRFSLKQIEAL
ECAYDNLCQTEGVTALPYFLIKYDENMVLVSLLKHYSDFFQGQRTKITIGVYDPCNLAQY
PGWPLRNFLVLAAHRWSSSFQSVEVVCFRDRTMQGARDVAHSIIFEVKLPEMAFSPDCPK
AVGWEKNQKGGMGPRMVNLSECMDPKRLAESSVDLNLKLMCWRLVPTLDLDKVVSVKCLL
LGAGTLGCNVARTLMGWGVRHITFVDNAKISYSNPVRQPLYEFEDCLGGGKPKALAAADR
LQKIFPGVNARGFNMSIPMPGHPVNFSSVTLEQARRDVEQLEQLIESHDVVFLLMDTRES
RWLPAVIAASKRKLVINAALGFDTFVVMRHGLKKPKQQGAGDLCPNHPVASADLLGSSLF
ANIPGYKLGCYFCNDVVAPGDSTRDRTLDQQCTVSRPGLAVIAGALAVELMVSVLQHPEG
GYAIASSSDDRMNEPPTSLGLVPHQIRGFLSRFDNVLPVSLAFDKCTACSSKVLDQYERE
GFNFLAKVFNSSHSFLEDLTGLTLLHQETQAAEIWDMSDDETI
NT seq 2112 nt   +upstreamnt  +downstreamnt
atggcggcagctacgggggatcctggactctctaaactgcagtttgccccttttagtagt
gccttggatgttgggttttggcatgagttgacccagaagaagctgaacgagtatcggctg
gatgaagctcccaaggacattaagggttattactacaatggtgactctgctgggctgcca
gctcgcttaacattggagttcagtgcttttgacatgagtgctcccaccccagcccgttgc
tgcccagctattggaacactgtataacaccaacacactcgagtctttcaagactgcagat
aagaagctccttttggaacaagcagcaaatgagatatgggaatccataaaatcaggcact
gctcttgaaaaccctgtactcctcaacaagttcctcctcttgacatttgcagatctaaag
aagtaccacttctactattggttttgctatcctgccctctgtcttccagagagtttacct
ctcattcaggggccagtgggtttggatcaaaggttttcactaaaacagattgaagcacta
gagtgtgcatatgataatctttgtcaaacagaaggagtcacagctcttccttacttctta
atcaagtatgatgagaacatggtgctggtttccttgcttaaacactacagtgatttcttc
caaggtcaaaggacgaagataacaattggtgtatatgatccctgtaacttagcccagtac
cctggatggcctttgaggaattttttggtcctagcagcccacagatggagtagcagtttc
cagtctgttgaagttgtttgcttccgtgaccgtaccatgcagggggcgagagacgttgcc
cacagcatcatcttcgaagtgaagcttccagaaatggcatttagcccagattgtcctaaa
gcagttggatgggaaaagaaccagaaaggaggcatgggaccaaggatggtgaacctcagt
gaatgtatggaccctaaaaggttagctgagtcatcagtggatctaaatctcaaactgatg
tgttggagattggttcctactttagacttggacaaggttgtgtctgtcaaatgtctgctg
cttggagccggcaccttgggttgcaatgtagctaggacgttgatgggttggggcgtgaga
cacatcacatttgtggacaatgccaagatctcctactccaatcctgtgaggcagcctctc
tatgagtttgaagattgcctagggggtggtaagcccaaggctctggcagcagcggaccgg
ctccagaaaatattccccggtgtgaatgccagaggattcaacatgagcatacctatgcct
gggcatccagtgaacttctccagtgtcactctggagcaagcccgcagagatgtggagcaa
ctggagcagctcatcgaaagccatgatgtcgtcttcctattgatggacaccagggagagc
cggtggcttcctgccgtcattgctgcaagcaagagaaagctggtcatcaatgctgctttg
ggatttgacacatttgttgtcatgagacatggtctgaagaaaccaaagcagcaaggagct
ggggacttgtgtccaaaccaccctgtggcatctgctgacctcctgggctcatcgcttttt
gccaacatccctggttacaagcttggctgctacttctgcaatgatgtggtggccccagga
gattcaaccagagaccggaccttggaccagcagtgcactgtgagtcgtccaggactggcc
gtgattgcaggagccctggccgtggaattgatggtatctgttttgcagcatccagaaggg
ggctatgccattgccagcagcagtgacgatcggatgaatgagcctccaacctctcttggg
cttgtgcctcaccagatccggggatttctttcacggtttgataatgtccttcccgtcagc
ctggcatttgacaaatgtacagcttgttcttccaaagttcttgatcaatatgaacgagaa
ggatttaacttcctagccaaggtgtttaattcttcacattccttcttagaagacttgact
ggtcttacattgctgcatcaagaaacccaagctgctgagatctgggacatgagcgatgat
gagaccatctga

KEGG   Homo sapiens (human): 64422
Entry
64422             CDS       T01001                                 
Symbol
ATG3, APG3, APG3-LIKE, APG3L, PC3-96, hApg3
Name
(RefSeq) autophagy related 3
  KO
K08343  ubiquitin-like-conjugating enzyme ATG3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04136  Autophagy - other
hsa04140  Autophagy - animal
hsa05167  Kaposi sarcoma-associated herpesvirus infection
Network
nt06128  Autophagy (viruses and bacteria)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06228  Autophagy
  Element
N00156  Autophagy-vesicle elongation
N00176  KSHV vFLIP to autophagy-vesicle elongation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    64422 (ATG3)
   04136 Autophagy - other
    64422 (ATG3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    64422 (ATG3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    64422 (ATG3)
   04121 Ubiquitin system [BR:hsa04121]
    64422 (ATG3)
   03029 Mitochondrial biogenesis [BR:hsa03029]
    64422 (ATG3)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Autophagosome formation proteins
   Atg8 conjugation proteins
    64422 (ATG3)
Ubiquitin system [BR:hsa04121]
 Ubiquitin-conjugating enzymes (E2)
  UBL-conjugating enzymes
   64422 (ATG3)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    64422 (ATG3)
SSDB
Motif
Pfam: Autophagy_act_C DUF5791 SDA1
Other DBs
NCBI-GeneID: 64422
NCBI-ProteinID: NP_071933
OMIM: 609606
HGNC: 20962
Ensembl: ENSG00000144848
Pharos: Q9NT62(Tbio)
UniProt: Q9NT62
Structure
LinkDB
Position
3:complement(112532510..112561962)
AA seq 314 aa
MQNVINTVKGKALEVAEYLTPVLKESKFKETGVITPEEFVAAGDHLVHHCPTWQWATGEE
LKVKAYLPTGKQFLVTKNVPCYKRCKQMEYSDELEAIIEEDDGDGGWVDTYHNTGITGIT
EAVKEITLENKDNIRLQDCSALCEEEEDEDEGEAADMEEYEESGLLETDEATLDTRKIVE
ACKAKTDAGGEDAILQTRTYDLYITYDKYYQTPRLWLFGYDEQRQPLTVEHMYEDISQDH
VKKTVTIENHPHLPPPPMCSVHPCRHAEVMKKIIETVAEGGGELGVHMYLLIFLKFVQAV
IPTIEYDYTRHFTM
NT seq 945 nt   +upstreamnt  +downstreamnt
atgcagaatgtgattaatactgtgaagggaaaggcactggaagtggctgagtacctgacc
ccggtcctcaaggaatcaaagtttaaggaaacaggtgtaattaccccagaagagtttgtg
gcagctggagatcacctagtccaccactgtccaacatggcaatgggctacaggggaagaa
ttgaaagtgaaggcatacctaccaacaggcaaacaatttttggtaaccaaaaatgtgccg
tgctataagcggtgcaaacagatggaatattcagatgaattggaagctatcattgaagaa
gatgatggtgatggcggatgggtagatacatatcacaacacaggtattacaggaataacg
gaagccgttaaagagatcacactggaaaataaggacaatataaggcttcaagattgctca
gcactatgtgaagaggaagaagatgaagatgaaggagaagctgcagatatggaagaatat
gaagagagtggattgttggaaacagatgaggctaccctagatacaaggaaaatagtagaa
gcttgtaaagccaaaactgatgctggcggtgaagatgctattttgcaaaccagaacttat
gacctttacatcacttatgataaatattaccagactccacgattatggttgtttggctat
gatgagcaacggcagcctttaacagttgagcacatgtatgaagacatcagtcaggatcat
gtgaagaaaacagtgaccattgaaaatcaccctcatctgccaccacctcccatgtgttca
gttcacccatgcaggcatgctgaggtgatgaagaaaatcattgagactgttgcagaagga
gggggagaacttggagttcatatgtatcttcttattttcttgaaatttgtacaagctgtc
attccaacaatagaatatgactacacaagacacttcacaatgtaa

KEGG   Homo sapiens (human): 9140
Entry
9140              CDS       T01001                                 
Symbol
ATG12, APG12, APG12L, FBR93, HAPG12
Name
(RefSeq) autophagy related 12
  KO
K08336  ubiquitin-like protein ATG12
Organism
hsa  Homo sapiens (human)
Pathway
hsa04068  FoxO signaling pathway
hsa04136  Autophagy - other
hsa04140  Autophagy - animal
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa05131  Shigellosis
Network
nt06128  Autophagy (viruses and bacteria)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06228  Autophagy
  Element
N00156  Autophagy-vesicle elongation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    9140 (ATG12)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    9140 (ATG12)
   04136 Autophagy - other
    9140 (ATG12)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    9140 (ATG12)
   04622 RIG-I-like receptor signaling pathway
    9140 (ATG12)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05131 Shigellosis
    9140 (ATG12)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    9140 (ATG12)
   04121 Ubiquitin system [BR:hsa04121]
    9140 (ATG12)
   03029 Mitochondrial biogenesis [BR:hsa03029]
    9140 (ATG12)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    9140 (ATG12)
Ubiquitin system [BR:hsa04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   9140 (ATG12)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    9140 (ATG12)
SSDB
Motif
Pfam: APG12 ATG8
Other DBs
NCBI-GeneID: 9140
NCBI-ProteinID: NP_004698
OMIM: 609608
HGNC: 588
Ensembl: ENSG00000145782
Pharos: O94817(Tbio)
UniProt: O94817
Structure
LinkDB
Position
5:complement(115828200..115841565)
AA seq 140 aa
MAEEPQSVLQLPTSIAAGGEGLTDVSPETTTPEPPSSAAVSPGTEEPAGDTKKKIDILLK
AVGDTPIMKTKKWAVERTRTIQGLIDFIKKFLKLVASEQLFIYVNQSFAPSPDQEVGTLY
ECFGSDGKLVLHYCKSQAWG
NT seq 423 nt   +upstreamnt  +downstreamnt
atggcggaggagccgcagtctgtgttgcagcttcctacttcaattgctgctggaggggaa
ggacttacggatgtctccccagaaacaaccaccccggagcccccgtcttccgctgcagtt
tccccgggaacagaggaacctgctggcgacaccaagaaaaaaattgacattttgctaaag
gctgtgggagacactcctattatgaaaacaaagaagtgggcagtagagcgaacacgaacc
atccaaggactcattgacttcatcaaaaagtttcttaaacttgtggcctcagaacagttg
tttatttatgtgaatcagtcctttgctccttccccagaccaagaagttggaactctctat
gagtgttttggcagtgatggtaaactggttttacattactgcaagtctcaggcgtgggga
tga

KEGG   Homo sapiens (human): 9474
Entry
9474              CDS       T01001                                 
Symbol
ATG5, APG5, APG5-LIKE, APG5L, ASP, SCAR25, hAPG5
Name
(RefSeq) autophagy related 5
  KO
K08339  autophagy-related protein 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04136  Autophagy - other
hsa04137  Mitophagy - animal
hsa04140  Autophagy - animal
hsa04211  Longevity regulating pathway
hsa04213  Longevity regulating pathway - multiple species
hsa04216  Ferroptosis
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa05131  Shigellosis
Network
nt06128  Autophagy (viruses and bacteria)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06228  Autophagy
  Element
N00156  Autophagy-vesicle elongation
Disease
H01891  Autosomal recessive spinocerebellar ataxias
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    9474 (ATG5)
   04136 Autophagy - other
    9474 (ATG5)
   04137 Mitophagy - animal
    9474 (ATG5)
  09143 Cell growth and death
   04216 Ferroptosis
    9474 (ATG5)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    9474 (ATG5)
   04622 RIG-I-like receptor signaling pathway
    9474 (ATG5)
  09149 Aging
   04211 Longevity regulating pathway
    9474 (ATG5)
   04213 Longevity regulating pathway - multiple species
    9474 (ATG5)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05131 Shigellosis
    9474 (ATG5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    9474 (ATG5)
   03029 Mitochondrial biogenesis [BR:hsa03029]
    9474 (ATG5)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    9474 (ATG5)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    9474 (ATG5)
SSDB
Motif
Pfam: APG5 DUF6782
Other DBs
NCBI-GeneID: 9474
NCBI-ProteinID: NP_001273035
OMIM: 604261
HGNC: 589
Ensembl: ENSG00000057663
Pharos: Q9H1Y0(Tbio)
UniProt: Q9H1Y0 A9UGY9 Q7Z3H3
Structure
LinkDB
Position
6:complement(106184476..106325760)
AA seq 275 aa
MTDDKDVLRDVWFGRIPTCFTLYQDEITEREAEPYYLLLPRVSYLTLVTDKVKKHFQKVM
RQEDISEIWFEYEGTPLKWHYPIGLLFDLLASSSALPWNITVHFKSFPEKDLLHCPSKDA
IEAHFMSCMKEADALKHKSQVINEMQKKDHKQLWMGLQNDRFDQFWAINRKLMEYPAEEN
GFRYIPFRIYQTTTERPFIQKLFRPVAADGQLHTLGDLLKEVCPSAIDPEDGEKKNQVMI
HGIEPMLETPLQWLSEHLSYPDNFLHISIIPQPTD
NT seq 828 nt   +upstreamnt  +downstreamnt
atgacagatgacaaagatgtgcttcgagatgtgtggtttggacgaattccaacttgtttc
acgctatatcaggatgagataactgaaagggaagcagaaccatactatttgcttttgcca
agagtaagttatttgacgttggtaactgacaaagtgaaaaagcactttcagaaggttatg
agacaagaagacattagtgagatatggtttgaatatgaaggcacaccactgaaatggcat
tatccaattggtttgctatttgatcttcttgcatcaagttcagctcttccttggaacatc
acagtacattttaagagttttccagaaaaagaccttctgcactgtccatctaaggatgca
attgaagctcattttatgtcatgtatgaaagaagctgatgctttaaaacataaaagtcaa
gtaatcaatgaaatgcagaaaaaagatcacaagcaactctggatgggattgcaaaatgac
agatttgaccagttttgggccatcaatcggaaactcatggaatatcctgcagaagaaaat
ggatttcgttatatcccctttagaatatatcagacaacgactgaaagacctttcattcag
aagctgtttcgtcctgtggctgcagatggacagttgcacacactaggagatctcctcaaa
gaagtttgtccttctgctattgatcctgaagatggggaaaaaaagaatcaagtgatgatt
catggaattgagccaatgttggaaacacctctgcagtggctgagtgaacatctgagctac
ccggataattttcttcatattagtatcatcccacagccaacagattga

KEGG   Homo sapiens (human): 55054
Entry
55054             CDS       T01001                                 
Symbol
ATG16L1, APG16L, ATG16A, ATG16L, IBD10, WDR30
Name
(RefSeq) autophagy related 16 like 1
  KO
K17890  autophagy-related protein 16-1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04136  Autophagy - other
hsa04140  Autophagy - animal
hsa04621  NOD-like receptor signaling pathway
hsa05131  Shigellosis
Network
nt06128  Autophagy (viruses and bacteria)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06228  Autophagy
  Element
N00156  Autophagy-vesicle elongation
N01284  Shigella IcsP to Autophagy-vesicle elongation
Disease
H00286  Crohn disease
H01227  Inflammatory bowel disease (IBD)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    55054 (ATG16L1)
   04136 Autophagy - other
    55054 (ATG16L1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    55054 (ATG16L1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05131 Shigellosis
    55054 (ATG16L1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    55054 (ATG16L1)
   03029 Mitochondrial biogenesis [BR:hsa03029]
    55054 (ATG16L1)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    55054 (ATG16L1)
 Others
  Rab GTPases of specific organelles
   Auto phagosome
    55054 (ATG16L1)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    55054 (ATG16L1)
SSDB
Motif
Pfam: ATG16 WD40 ANAPC4_WD40 eIF2A NBCH_WD40 Ge1_WD40 TolB_like
Other DBs
NCBI-GeneID: 55054
NCBI-ProteinID: NP_110430
OMIM: 610767
HGNC: 21498
Ensembl: ENSG00000085978
Pharos: Q676U5(Tbio)
UniProt: Q676U5 Q17RG0
Structure
LinkDB
Position
2:233251673..233295669
AA seq 607 aa
MSSGLRAADFPRWKRHISEQLRRRDRLQRQAFEEIILQYNKLLEKSDLHSVLAQKLQAEK
HDVPNRHEISPGHDGTWNDNQLQEMAQLRIKHQEELTELHKKRGELAQLVIDLNNQMQRK
DREMQMNEAKIAECLQTISDLETECLDLRTKLCDLERANQTLKDEYDALQITFTALEGKL
RKTTEENQELVTRWMAEKAQEANRLNAENEKDSRRRQARLQKELAEAAKEPLPVEQDDDI
EVIVDETSDHTEETSPVRAISRAATKRLSQPAGGLLDSITNIFGRRSVSSFPVPQDNVDT
HPGSGKEVRVPATALCVFDAHDGEVNAVQFSPGSRLLATGGMDRRVKLWEVFGEKCEFKG
SLSGSNAGITSIEFDSAGSYLLAASNDFASRIWTVDDYRLRHTLTGHSGKVLSAKFLLDN
ARIVSGSHDRTLKLWDLRSKVCIKTVFAGSSCNDIVCTEQCVMSGHFDKKIRFWDIRSES
IVREMELLGKITALDLNPERTELLSCSRDDLLKVIDLRTNAIKQTFSAPGFKCGSDWTRV
VFSPDGSYVAAGSAEGSLYIWSVLTGKVEKVLSKQHSSSINAVAWSPSGSHVVSVDKGCK
AVLWAQY
NT seq 1824 nt   +upstreamnt  +downstreamnt
atgtcgtcgggcctccgcgccgctgacttcccccgctggaagcgccacatctcggagcaa
ctgaggcgccgggaccggctgcagagacaggcgttcgaggagatcatcctgcagtataac
aaattgctggaaaagtcagatcttcattcagtgttggcccagaaactacaggctgaaaag
catgacgtaccaaacaggcacgagataagtcccggacatgatggcacatggaatgacaat
cagctacaagaaatggcccaactgaggattaagcaccaagaggaactgactgaattacac
aagaaacgtggggagttagctcaactggtgattgacctgaataaccaaatgcagcggaag
gacagggagatgcagatgaatgaagcaaaaattgcagaatgtttgcagactatctctgac
ctggagacggagtgcctagacctgcgcactaagctttgtgaccttgaaagagccaaccag
accctgaaggatgaatatgatgccctgcagatcacttttactgccttggagggaaaactg
aggaaaactacggaagagaaccaggagctggtcaccagatggatggctgagaaagcccag
gaagccaatcggcttaatgcagagaatgaaaaagactccaggaggcggcaagcccggctg
cagaaagagcttgcagaagcagcaaaggaacctctaccagtcgaacaggatgatgacatt
gaggtcattgtggatgaaacttctgatcacacagaagagacctctcctgtgcgagccatc
agcagagcagccactaagcgactctcgcagcctgctggaggccttctggattctatcact
aatatctttgggagacgctctgtctcttccttcccagtcccccaggacaatgtggatact
catcctggttctggtaaagaagtgagggtaccagctactgccttgtgtgtcttcgatgca
catgatggggaagtcaacgctgtgcagttcagtccaggttcccggttactggccactgga
ggcatggaccgcagggttaagctttgggaagtatttggagaaaaatgtgagttcaagggt
tccctatctggcagtaatgcaggaattacaagcattgaatttgatagtgctggatcttac
ctcttagcagcttcaaatgattttgcaagccgaatctggactgtggatgattatcgatta
cggcacacactcacgggacacagtgggaaagtgctgtctgctaagttcctgctggacaat
gcgcggattgtctcaggaagtcacgaccggactctcaaactctgggatctacgcagcaaa
gtctgcataaagacagtgtttgcaggatccagttgcaatgatattgtctgcacagagcaa
tgtgtaatgagtggacattttgacaagaaaattcgtttctgggacattcgatcagagagc
atagttcgagagatggagctgttgggaaagattactgccctggacttaaacccagaaagg
actgagctcctgagctgctcccgtgatgacttgctaaaagttattgatctccgaacaaat
gctatcaagcagacattcagtgcacctgggttcaagtgcggctctgactggaccagagtt
gtcttcagccctgatggcagttacgtggcggcaggctctgctgagggctctctgtatatc
tggagtgtgctcacagggaaagtggaaaaggttctttcaaagcagcacagctcatccatc
aatgcggtggcgtggtcgccctctggctcgcacgttgtcagtgtggacaaaggatgcaaa
gctgtgctgtgggcacagtactga

KEGG   Homo sapiens (human): 89849
Entry
89849             CDS       T01001                                 
Symbol
ATG16L2, ATG16B, WDR80
Name
(RefSeq) autophagy related 16 like 2
  KO
K20868  autophagy-related protein 16-2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04140  Autophagy - animal
Network
nt06128  Autophagy (viruses and bacteria)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06228  Autophagy
  Element
N00156  Autophagy-vesicle elongation
N01284  Shigella IcsP to Autophagy-vesicle elongation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    89849 (ATG16L2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    89849 (ATG16L2)
   03029 Mitochondrial biogenesis [BR:hsa03029]
    89849 (ATG16L2)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    89849 (ATG16L2)
 Others
  Rab GTPases of specific organelles
   Auto phagosome
    89849 (ATG16L2)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    89849 (ATG16L2)
SSDB
Motif
Pfam: ATG16 WD40 NBCH_WD40 Crescentin Fez1
Other DBs
NCBI-GeneID: 89849
NCBI-ProteinID: NP_203746
OMIM: 618716
HGNC: 25464
Ensembl: ENSG00000168010
Pharos: Q8NAA4(Tbio)
UniProt: Q8NAA4 Q9H7Q5
LinkDB
Position
11:72814411..72843740
AA seq 619 aa
MAGPGVPGAPAARWKRHIVRQLRLRDRTQKALFLELVPAYNHLLEKAELLDKFSKKLQPE
PNSVTPTTHQGPWEESELDSDQVPSLVALRVKWQEEEEGLRLVCGEMAYQVVEKGAALGT
LESELQQRQSRLAALEARVAQLREARAQQAQQVEEWRAQNAVQRAAYEALRAHVGLREAA
LRRLQEEARDLLERLVQRKARAAAERNLRNERRERAKQARVSQELKKAAKRTVSISEGPD
TLGDGMRERRETLALAPEPEPLEKEACEKWKRPFRSASATSLTLSHCVDVVKGLLDFKKR
RGHSIGGAPEQRYQIIPVCVAARLPTRAQDVLDAHLSEVNAVRFGPNSSLLATGGADRLI
HLWNVVGSRLEANQTLEGAGGSITSVDFDPSGYQVLAATYNQAAQLWKVGEAQSKETLSG
HKDKVTAAKFKLTRHQAVTGSRDRTVKEWDLGRAYCSRTINVLSYCNDVVCGDHIIISGH
NDQKIRFWDSRGPHCTQVIPVQGRVTSLSLSHDQLHLLSCSRDNTLKVIDLRVSNIRQVF
RADGFKCGSDWTKAVFSPDRSYALAGSCDGALYIWDVDTGKLESRLQGPHCAAVNAVAWC
YSGSHMVSVDQGRKVVLWQ
NT seq 1860 nt   +upstreamnt  +downstreamnt
atggcggggccgggcgtccccggtgcccccgcagcgcgctggaaacgccacatcgtgcgg
cagctgcggcttcgggaccgtacgcaaaaggcgcttttcctggagctggtgccggcctat
aaccatctcttagagaaggctgagctgctggacaagttctcaaagaagctgcagccggag
ccaaacagtgtcactcccaccacccaccagggcccctgggaggagtcagagcttgactca
gaccaagtcccatcactggtcgcactgagggtgaagtggcaggaggaggaggaggggctc
cggctggtctgtggtgagatggcctaccaggtggtggagaagggcgcggccctgggcacg
ctggagtcggagctgcagcagaggcaaagcaggctggcagccctggaggcccgcgtggcg
cagctgcgagaggcgcgggcgcagcaggcccagcaggtggaggagtggcgggcgcagaat
gcggtgcagcgggcagcctacgaggcgctgcgcgcgcacgtcgggctccgggaggcggca
ctgcgcaggctccaggaagaggcgcgcgacctgctggagaggctcgtgcagcgcaaggcg
cgcgccgcggccgagcgcaacctgcgcaacgagcgccgggagcgggccaagcaggcgcgg
gtgtcccaggagctgaagaaggctgccaagcggaccgtgagcatcagcgagggcccggac
accctaggcgatgggatgagggagagaagggagactctggctctggcccctgagccagag
cccctggagaaggaagcttgtgagaagtggaagaggcccttcaggtctgcctcagccacc
tccctgacgctgtcccactgtgtggatgtggtgaaggggcttctggattttaagaagagg
agaggtcactcaattgggggagcccctgagcagcgataccagatcatccctgtgtgtgtg
gctgcccgacttcctacccgggctcaggatgtgctggatgcccacctctctgaggtcaat
gctgttcgttttggccccaacagcagcctcctggccactggaggggctgaccgcctgatc
cacctctggaatgttgtgggaagtcgcctggaggccaaccagaccctggagggagctggt
ggcagcatcaccagtgtggactttgacccctcgggctaccaggttttagcagcaacttac
aaccaggctgcccagctctggaaggtgggggaggcacagtccaaggagacactgtctgga
cacaaggataaggtgacagctgccaaattcaagctaacgaggcaccaggcagtgactggg
agccgcgaccggacagtgaaggagtgggacctcggccgtgcctattgctccaggaccatc
aatgtcctttcctactgtaatgacgtggtgtgtggggaccatatcatcattagtggccac
aatgaccagaagatccggttctgggacagcagggggccccactgcacccaggtcatccct
gtgcagggccgggtcacctccctgagcctcagccacgaccaactgcacctgctcagctgt
tcccgagacaacacactcaaggtcatcgacctgcgtgtcagcaacatccgccaggtgttc
agggccgatggcttcaagtgtggttctgactggaccaaagctgtgttcagcccggacaga
agctatgcactggcaggctcctgtgatggggccctttacatctgggatgtggacaccggg
aaactggagagcagactacagggaccccattgcgctgccgtcaacgccgtggcctggtgc
tactccgggagccacatggtgagcgtggaccagggcaggaaggttgtgctctggcagtag

DBGET integrated database retrieval system