KEGG   Homo sapiens (human): 10538
Entry
10538             CDS       T01001                                 
Symbol
BATF, B-ATF, BATF1, SFA-2, SFA2
Name
(RefSeq) basic leucine zipper ATF-like transcription factor
  KO
K09034  ATF-like basic leucine zipper transcriptional factor
Organism
hsa  Homo sapiens (human)
Pathway
hsa05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    10538 (BATF)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    10538 (BATF)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Fos
    10538 (BATF)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf Phlebovirus_NSM Sec34 TMCO5 AAA_11 HALZ Seryl_tRNA_N ATG14 TMPIT
Other DBs
NCBI-GeneID: 10538
NCBI-ProteinID: NP_006390
OMIM: 612476
HGNC: 958
Ensembl: ENSG00000156127
Pharos: Q16520(Tbio)
UniProt: Q16520
LinkDB
Position
14:75522469..75546992
AA seq 125 aa
MPHSSDSSDSSFSRSPPPGKQDSSDDVRRVQRREKNRIAAQKSRQRQTQKADTLHLESED
LEKQNAALRKEIKQLTEELKYFTSVLNSHEPLCSVLAASTPSPPEVVYSAHAFHQPHVSS
PRFQP
NT seq 378 nt   +upstreamnt  +downstreamnt
atgcctcacagctccgacagcagtgactccagcttcagccgctctcctccccctggcaaa
caggactcatctgatgatgtgagaagagttcagaggagggagaaaaatcgtattgccgcc
cagaagagccgacagaggcagacacagaaggccgacaccctgcacctggagagcgaagac
ctggagaaacagaacgcggctctacgcaaggagatcaagcagctcacagaggaactgaag
tacttcacgtcggtgctgaacagccacgagcccctgtgctcggtgctggccgccagcacg
ccctcgccccccgaggtggtgtacagcgcccacgcattccaccaacctcatgtcagctcc
ccgcgcttccagccctga

KEGG   Homo sapiens (human): 116071
Entry
116071            CDS       T01001                                 
Symbol
BATF2, SARI
Name
(RefSeq) basic leucine zipper ATF-like transcription factor 2
  KO
K09034  ATF-like basic leucine zipper transcriptional factor
Organism
hsa  Homo sapiens (human)
Pathway
hsa05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    116071 (BATF2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    116071 (BATF2)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Fos
    116071 (BATF2)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf HALZ HAP1_N DUF3287
Other DBs
NCBI-GeneID: 116071
NCBI-ProteinID: NP_612465
OMIM: 614983
HGNC: 25163
Ensembl: ENSG00000168062
Pharos: Q8N1L9(Tbio)
UniProt: Q8N1L9
LinkDB
Position
11:complement(64987945..64996971)
AA seq 274 aa
MHLCGGNGLLTQTDPKEQQRQLKKQKNRAAAQRSRQKHTDKADALHQQHESLEKDNLALR
KEIQSLQAELAWWSRTLHVHERLCPMDCASCSAPGLLGCWDQAEGLLGPGPQGQHGCREQ
LELFQTPGSCYPAQPLSPGPQPHDSPSLLQCPLPSLSLGPAVVAEPPVQLSPSPLLFASH
TGSSLQGSSSKLSALQPSLTAQTAPPQPLELEHPTRGKLGSSPDNPSSALGLARLQSREH
KPALSAATWQGLVVDPSPHPLLAFPLLSSAQVHF
NT seq 825 nt   +upstreamnt  +downstreamnt
atgcacctctgtgggggcaatgggctgctgacccagacagaccccaaggagcaacaaagg
cagctgaagaagcagaagaaccgggcagccgcccagcgaagccggcagaagcacacagac
aaggcagacgccctgcaccagcagcacgagtctctggaaaaagacaacctcgccctgcgg
aaggagatccagtccctgcaggccgagctggcgtggtggagccggaccctgcacgtgcat
gagcgcctgtgccccatggattgtgcctcctgctcagctccagggctcctgggctgctgg
gaccaggctgaggggctcctgggccctggcccacagggacaacatggctgccgggagcag
ctggagctgttccagaccccgggttcctgttacccagctcagccgctctctccaggtcca
cagcctcatgattctcccagcctcctccagtgccccctgccctcactgtcccttggcccc
gctgtggttgctgaacctcctgtccagctgtcccccagccctctcctgtttgcctcgcac
actggttccagcctgcaggggtcttcctctaagctcagtgccctccagcccagcctcacg
gcccaaactgcccctccacagcccctcgagctggagcatcccaccagagggaagctgggg
tcctctcccgacaacccttcctctgccctggggcttgcacgtctgcagagcagggagcac
aaacctgctctctcagcagccacttggcaagggctggttgtggatcccagccctcaccct
ctcctggcctttcctctgctctcctctgctcaagtccacttctaa

KEGG   Homo sapiens (human): 55509
Entry
55509             CDS       T01001                                 
Symbol
BATF3, JDP1, JUNDM1, SNFT
Name
(RefSeq) basic leucine zipper ATF-like transcription factor 3
  KO
K09034  ATF-like basic leucine zipper transcriptional factor
Organism
hsa  Homo sapiens (human)
Pathway
hsa05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    55509 (BATF3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    55509 (BATF3)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Fos
    55509 (BATF3)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf HALZ ATG16 HAUS-augmin3 DUF3450 Uso1_p115_C HAP1_N Ribosomal_L30_N Eap1 CCDC22 DivIC DUF16 TMF_DNA_bd Prominin Cnn_1N DUF6779 HlyD_2 ZapB FapA TMCO5 WDCP Baculo_gp64 CENP-H DUF2205
Other DBs
NCBI-GeneID: 55509
NCBI-ProteinID: NP_061134
OMIM: 612470
HGNC: 28915
Ensembl: ENSG00000123685
Pharos: Q9NR55(Tdark)
UniProt: Q9NR55
LinkDB
Position
1:complement(212686417..212699840)
AA seq 127 aa
MSQGLPAAGSVLQRSVAAPGNQPQPQPQQQSPEDDDRKVRRREKNRVAAQRSRKKQTQKA
DKLHEEYESLEQENTMLRREIGKLTEELKHLTEALKEHEKMCPLLLCPMNFVPVPPRPDP
VAGCLPR
NT seq 384 nt   +upstreamnt  +downstreamnt
atgtcgcaagggctcccggccgccggcagcgtcctgcagaggagcgtcgcggcgcccggg
aaccagccgcagccgcagccgcagcagcagagccctgaggatgatgacaggaaggtccga
aggagagaaaaaaaccgagttgctgctcagagaagtcggaagaagcagacccagaaggct
gacaagctccatgaggaatatgagagcctggagcaagaaaacaccatgctgcggagagag
atcgggaagctgacagaggagctgaagcacctgacagaggcactgaaggagcacgagaag
atgtgcccgctgctgctctgccctatgaactttgtgccagtgcctccccggccggaccct
gtggccggctgcttgccccgatga

DBGET integrated database retrieval system