KEGG   Homo sapiens (human): 10544
Entry
10544             CDS       T01001                                 
Symbol
PROCR, CCCA, CCD41, EPCR
Name
(RefSeq) protein C receptor
  KO
K06557  protein C receptor, endothelial (EPCR)
Organism
hsa  Homo sapiens (human)
Pathway
hsa04610  Complement and coagulation cascades
Network
nt06514  Coagulation cascade
  Element
N01515  Regulation of coagulation cascade, protein C system
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    10544 (PROCR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    10544 (PROCR)
CD molecules [BR:hsa04090]
 Proteins
  10544 (PROCR)
SSDB
Motif
Pfam: MHC_I_3 MHC_I DUF4424
Other DBs
NCBI-GeneID: 10544
NCBI-ProteinID: NP_006395
OMIM: 600646
HGNC: 9452
Ensembl: ENSG00000101000
Pharos: Q9UNN8(Tbio)
UniProt: Q9UNN8
Structure
LinkDB
Position
20:35171096..35216259
AA seq 238 aa
MLTTLLPILLLSGWAFCSQDASDGLQRLHMLQISYFRDPYHVWYQGNASLGGHLTHVLEG
PDTNTTIIQLQPLQEPESWARTQSGLQSYLLQFHGLVRLVHQERTLAFPLTIRCFLGCEL
PPEGSRAHVFFEVAVNGSSFVSFRPERALWQADTQVTSGVVTFTLQQLNAYNRTRYELRE
FLEDTCVQYVQKHISAENTKGSQTSRSYTSLVLGVLVGSFIIAGVAVGIFLCTGGRRC
NT seq 717 nt   +upstreamnt  +downstreamnt
atgttgacaacattgctgccgatactgctgctgtctggctgggccttttgtagccaagac
gcctcagatggcctccaaagacttcatatgctccagatctcctacttccgcgacccctat
cacgtgtggtaccagggcaacgcgtcgctggggggacacctaacgcacgtgctggaaggc
ccagacaccaacaccacgatcattcagctgcagcccttgcaggagcccgagagctgggcg
cgcacgcagagtggcctgcagtcctacctgctccagttccacggcctcgtgcgcctggtg
caccaggagcggaccttggcctttcctctgaccatccgctgcttcctgggctgtgagctg
cctcccgagggctctagagcccatgtcttcttcgaagtggctgtgaatgggagctccttt
gtgagtttccggccggagagagccttgtggcaggcagacacccaggtcacctccggagtg
gtcaccttcaccctgcagcagctcaatgcctacaaccgcactcggtatgaactgcgggaa
ttcctggaggacacctgtgtgcagtatgtgcagaaacatatttccgcggaaaacacgaaa
gggagccaaacaagccgctcctacacttcgctggtcctgggcgtcctggtgggcagtttc
atcattgctggtgtggctgtaggcatcttcctgtgcacaggtggacggcgatgttaa

DBGET integrated database retrieval system