KEGG   Homo sapiens (human): 1056
Entry
1056              CDS       T01001                                 
Symbol
CEL, BAL, BSDL, BSSL, CELL, CEase, FAP, FAPP, LIPA, MODY8
Name
(RefSeq) carboxyl ester lipase
  KO
K12298  bile salt-stimulated lipase [EC:3.1.1.3 3.1.1.13]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00100  Steroid biosynthesis
hsa00561  Glycerolipid metabolism
hsa01100  Metabolic pathways
hsa04972  Pancreatic secretion
hsa04975  Fat digestion and absorption
Module
hsa_M00098  Acylglycerol degradation
Disease
H00410  Maturity onset diabetes of the young (MODY)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    1056 (CEL)
   00561 Glycerolipid metabolism
    1056 (CEL)
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    1056 (CEL)
   04975 Fat digestion and absorption
    1056 (CEL)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    1056 (CEL)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.3  triacylglycerol lipase
     1056 (CEL)
    3.1.1.13  sterol esterase
     1056 (CEL)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   1056 (CEL)
SSDB
Motif
Pfam: COesterase Mucin-like BD-FAE Abhydrolase_3 Say1_Mug180
Other DBs
NCBI-GeneID: 1056
NCBI-ProteinID: NP_001798
OMIM: 114840
HGNC: 1848
Ensembl: ENSG00000170835
UniProt: B4DSX9 Q86SR3 O75612
LinkDB
Position
9:133061981..133071861
AA seq 753 aa
MGRLQLVVLGLTCCWAVASAAKLGAVYTEGGFVEGVNKKLGLLGDSVDIFKGIPFAAPTK
ALENPQPHPGWQGTLKAKNFKKRCLQATITQDSTYGDEDCLYLNIWVPQGRKQVSRDLPV
MIWIYGGAFLMGSGHGANFLNNYLYDGEEIATRGNVIVVTFNYRVGPLGFLSTGDANLPG
NYGLRDQHMAIAWVKRNIAAFGGDPNNITLFGESAGGASVSLQTLSPYNKGLIRRAISQS
GVALSPWVIQKNPLFWAKKVAEKVGCPVGDAARMAQCLKVTDPRALTLAYKVPLAGLEYP
MLHYVGFVPVIDGDFIPADPINLYANAADIDYIAGTNNMDGHIFASIDMPAINKGNKKVT
EEDFYKLVSEFTITKGLRGAKTTFDVYTESWAQDPSQENKKKTVVDFETDVLFLVPTEIA
LAQHRANAKSAKTYAYLFSHPSRMPVYPKWVGADHADDIQYVFGKPFATPTGYRPQDRTV
SKAMIAYWTNFAKTGDPNMGDSAVPTHWEPYTTENSGYLEITKKMGSSSMKRSLRTNFLR
YWTLTYLALPTVTDQEATPVPPTGDSEATPVPPTGDSETAPVPPTGDSGAPPVPPTGDSG
APPVPPTGDSGAPPVPPTGDSGAPPVPPTGDSGAPPVPPTGDSGAPPVPPTGDSGAPPVP
PTGDSGAPPVPPTGDAGPPPVPPTGDSGAPPVPPTGDSGAPPVTPTGDSETAPVPPTGDS
GAPPVPPTGDSEAAPVPPTDDSKEAQMPAVIRF
NT seq 2262 nt   +upstreamnt  +downstreamnt
atggggcgcctgcaactggttgtgttgggcctcacctgctgctgggcagtggcgagtgcc
gcgaagctgggcgccgtgtacacagaaggtgggttcgtggaaggcgtcaataagaagctc
ggcctcctgggtgactctgtggacatcttcaagggcatccccttcgcagctcccaccaag
gccctggaaaatcctcagccacatcctggctggcaagggaccctgaaggccaagaacttc
aagaagagatgcctgcaggccaccatcacccaggacagcacctacggggatgaagactgc
ctgtacctcaacatttgggtgccccagggcaggaagcaagtctcccgggacctgcccgtt
atgatctggatctatggaggcgccttcctcatggggtccggccatggggccaacttcctc
aacaactacctgtatgacggcgaggagatcgccacacgcggaaacgtcatcgtggtcacc
ttcaactaccgtgtcggcccccttgggttcctcagcactggggacgccaatctgccaggt
aactatggccttcgggatcagcacatggccattgcttgggtgaagaggaatatcgcggcc
ttcgggggggaccccaacaacatcacgctcttcggggagtctgctggaggtgccagcgtc
tctctgcagaccctctccccctacaacaagggcctcatccggcgagccatcagccagagc
ggcgtggccctgagtccctgggtcatccagaaaaacccactcttctgggccaaaaaggtg
gctgagaaggtgggttgccctgtgggtgatgccgccaggatggcccagtgtctgaaggtt
actgatccccgagccctgacgctggcctataaggtgccgctggcaggcctggagtacccc
atgctgcactatgtgggcttcgtccctgtcattgatggagacttcatccccgctgacccg
atcaacctgtacgccaacgccgccgacatcgactatatagcaggcaccaacaacatggac
ggccacatcttcgccagcatcgacatgcctgccatcaacaagggcaacaagaaagtcacg
gaggaggacttctacaagctggtcagtgagttcacaatcaccaaggggctcagaggcgcc
aagacgacctttgatgtctacaccgagtcctgggcccaggacccatcccaggagaataag
aagaagactgtggtggactttgagaccgatgtcctcttcctggtgcccaccgagattgcc
ctagcccagcacagagccaatgccaagagtgccaagacctacgcctacctgttttcccat
ccctctcggatgcccgtctaccccaaatgggtgggggccgaccatgcagatgacattcag
tacgttttcgggaagcccttcgccacccccacgggctaccggccccaagacaggacagtc
tctaaggccatgatcgcctactggaccaactttgccaaaacaggggaccccaacatgggc
gactcggctgtgcccacacactgggaaccctacactacggaaaacagcggctacctggag
atcaccaagaagatgggcagcagctccatgaagcggagcctgagaaccaacttcctgcgc
tactggaccctcacctatctggcgctgcccacagtgaccgaccaggaggccacccctgtg
ccccccacaggggactccgaggccactcccgtgccccccacgggtgactccgagaccgcc
cccgtgccgcccacgggtgactccggggccccccccgtgccgcccacgggtgactccggg
gccccccccgtgccgcccacgggtgactccggggccccccccgtgccgcccacgggtgac
tccggggccccccccgtgccgcccacgggtgactccggggccccccccgtgccgcccacg
ggtgactccggggccccccccgtgccgcccacgggtgactccggggccccccccgtgccg
cccacgggtgactccggcgccccccccgtgccgcccacgggtgacgccgggccccccccc
gtgccgcccacgggtgactccggcgccccccccgtgccgcccacgggtgactccggggcc
ccccccgtgacccccacgggtgactccgagaccgcccccgtgccgcccacgggtgactcc
ggggccccccctgtgccccccacgggtgactctgaggctgcccctgtgccccccacagat
gactccaaggaagctcagatgcctgcagtcattaggttttag

KEGG   Homo sapiens (human): 26279
Entry
26279             CDS       T01001                                 
Symbol
PLA2G2D, PLA2IID, SPLASH, sPLA2-IID, sPLA2S
Name
(RefSeq) phospholipase A2 group IID
  KO
K01047  secretory phospholipase A2 [EC:3.1.1.4]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00564  Glycerophospholipid metabolism
hsa00565  Ether lipid metabolism
hsa00590  Arachidonic acid metabolism
hsa00591  Linoleic acid metabolism
hsa00592  alpha-Linolenic acid metabolism
hsa01100  Metabolic pathways
hsa04014  Ras signaling pathway
hsa04270  Vascular smooth muscle contraction
hsa04972  Pancreatic secretion
hsa04975  Fat digestion and absorption
Drug target
Varespladib (DG01394): D06283
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    26279 (PLA2G2D)
   00565 Ether lipid metabolism
    26279 (PLA2G2D)
   00590 Arachidonic acid metabolism
    26279 (PLA2G2D)
   00591 Linoleic acid metabolism
    26279 (PLA2G2D)
   00592 alpha-Linolenic acid metabolism
    26279 (PLA2G2D)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    26279 (PLA2G2D)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    26279 (PLA2G2D)
  09154 Digestive system
   04972 Pancreatic secretion
    26279 (PLA2G2D)
   04975 Fat digestion and absorption
    26279 (PLA2G2D)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    26279 (PLA2G2D)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     26279 (PLA2G2D)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation proteins
   Centriole proteins
    26279 (PLA2G2D)
SSDB
Motif
Pfam: Phospholip_A2_1 DUF5460
Other DBs
NCBI-GeneID: 26279
NCBI-ProteinID: NP_036532
OMIM: 605630
HGNC: 9033
Ensembl: ENSG00000117215
Pharos: Q9UNK4(Tchem)
UniProt: Q9UNK4
LinkDB
Position
1:complement(20111939..20119536)
AA seq 145 aa
MELALLCGLVVMAGVIPIQGGILNLNKMVKQVTGKMPILSYWPYGCHCGLGGRGQPKDAT
DWCCQTHDCCYDHLKTQGCSIYKDYYRYNFSQGNIHCSDKGSWCEQQLCACDKEVAFCLK
RNLDTYQKRLRFYWRPHCRGQTPGC
NT seq 438 nt   +upstreamnt  +downstreamnt
atggaacttgcactgctgtgtgggctggtggtgatggctggtgtgattccaatccagggc
gggatcctgaacctgaacaagatggtcaagcaagtgactgggaaaatgcccatcctctcc
tactggccctacggctgtcactgcggactaggtggcagaggccaacccaaagatgccacg
gactggtgctgccagacccatgactgctgctatgaccacctgaagacccaggggtgcagc
atctacaaggactattacagatacaacttttcccaggggaacatccactgctctgacaag
ggaagctggtgtgagcagcagctgtgtgcctgtgacaaggaggtggccttctgcctgaag
cgcaacctggacacctaccagaagcgactgcgtttctactggcggccccactgccggggg
cagacccctgggtgctag

KEGG   Homo sapiens (human): 30814
Entry
30814             CDS       T01001                                 
Symbol
PLA2G2E, GIIE_sPLA2, sPLA2-IIE
Name
(RefSeq) phospholipase A2 group IIE
  KO
K01047  secretory phospholipase A2 [EC:3.1.1.4]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00564  Glycerophospholipid metabolism
hsa00565  Ether lipid metabolism
hsa00590  Arachidonic acid metabolism
hsa00591  Linoleic acid metabolism
hsa00592  alpha-Linolenic acid metabolism
hsa01100  Metabolic pathways
hsa04014  Ras signaling pathway
hsa04270  Vascular smooth muscle contraction
hsa04972  Pancreatic secretion
hsa04975  Fat digestion and absorption
Drug target
Varespladib (DG01394): D06283
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    30814 (PLA2G2E)
   00565 Ether lipid metabolism
    30814 (PLA2G2E)
   00590 Arachidonic acid metabolism
    30814 (PLA2G2E)
   00591 Linoleic acid metabolism
    30814 (PLA2G2E)
   00592 alpha-Linolenic acid metabolism
    30814 (PLA2G2E)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    30814 (PLA2G2E)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    30814 (PLA2G2E)
  09154 Digestive system
   04972 Pancreatic secretion
    30814 (PLA2G2E)
   04975 Fat digestion and absorption
    30814 (PLA2G2E)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    30814 (PLA2G2E)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     30814 (PLA2G2E)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation proteins
   Centriole proteins
    30814 (PLA2G2E)
SSDB
Motif
Pfam: Phospholip_A2_1
Other DBs
NCBI-GeneID: 30814
NCBI-ProteinID: NP_055404
OMIM: 618320
HGNC: 13414
Ensembl: ENSG00000188784
Pharos: Q9NZK7(Tchem)
UniProt: Q9NZK7
Structure
LinkDB
Position
1:complement(19920009..19923617)
AA seq 142 aa
MKSPHVLVFLCLLVALVTGNLVQFGVMIEKMTGKSALQYNDYGCYCGIGGSHWPVDQTDW
CCHAHDCCYGRLEKLGCEPKLEKYLFSVSERGIFCAGRTTCQRLTCECDKRAALCFRRNL
GTYNRKYAHYPNKLCTGPTPPC
NT seq 429 nt   +upstreamnt  +downstreamnt
atgaaatctccccacgtgctggtgttcctttgcctcctggtggctctggtcaccgggaac
ctggttcagtttggggtgatgatcgagaagatgacaggcaagtccgccctgcagtacaac
gactatggctgttactgcggcatcggtggctcccactggccggtggaccagactgactgg
tgctgccacgcccacgactgctgctacgggcgtctggagaagctgggctgtgagcccaaa
ctggaaaagtatcttttctctgtcagcgaacgtggcattttctgcgccggcaggaccacc
tgccagcggctgacctgcgagtgtgacaagagggctgccctctgctttcgccgcaacctg
ggcacctacaaccgcaaatatgcccattatcccaacaagctgtgcaccgggcccaccccg
ccctgctga

KEGG   Homo sapiens (human): 391013
Entry
391013            CDS       T01001                                 
Symbol
PLA2G2C, UBXN10-AS1
Name
(RefSeq) phospholipase A2 group IIC
  KO
K01047  secretory phospholipase A2 [EC:3.1.1.4]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00564  Glycerophospholipid metabolism
hsa00565  Ether lipid metabolism
hsa00590  Arachidonic acid metabolism
hsa00591  Linoleic acid metabolism
hsa00592  alpha-Linolenic acid metabolism
hsa01100  Metabolic pathways
hsa04014  Ras signaling pathway
hsa04270  Vascular smooth muscle contraction
hsa04972  Pancreatic secretion
hsa04975  Fat digestion and absorption
Drug target
Varespladib (DG01394): D06283
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    391013 (PLA2G2C)
   00565 Ether lipid metabolism
    391013 (PLA2G2C)
   00590 Arachidonic acid metabolism
    391013 (PLA2G2C)
   00591 Linoleic acid metabolism
    391013 (PLA2G2C)
   00592 alpha-Linolenic acid metabolism
    391013 (PLA2G2C)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    391013 (PLA2G2C)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    391013 (PLA2G2C)
  09154 Digestive system
   04972 Pancreatic secretion
    391013 (PLA2G2C)
   04975 Fat digestion and absorption
    391013 (PLA2G2C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    391013 (PLA2G2C)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     391013 (PLA2G2C)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation proteins
   Centriole proteins
    391013 (PLA2G2C)
SSDB
Motif
Pfam: Phospholip_A2_1
Other DBs
NCBI-GeneID: 391013
NCBI-ProteinID: NP_001354898
HGNC: 9032
Ensembl: ENSG00000187980
UniProt: Q5R387
LinkDB
Position
1:complement(20163055..20186518)
AA seq 149 aa
MKVIAILTLLLFCSPTHSSFWQFQRRVKHITGRSAFFSYYGYGCYCGLGDKGIPVDDTDR
HSPSSPSPYEKLKEFSCQPVLNSYQFHIVNGAVVCGCTLGPGASCHCRLKACECDKQSVH
CFKESLPTYEKNFKQFSSQPRCGRHKPWC
NT seq 450 nt   +upstreamnt  +downstreamnt
atgaaggtcattgccatcctcaccctcctcctcttctgctcccccacccacagcagtttc
tggcagtttcagaggagggtcaaacacatcacggggcgaagtgccttcttctcatattac
ggatatggctgctactgtgggcttggggataaagggatccccgtggatgacactgacagg
cacagcccctcatctccctctccctacgagaagctgaaggagttcagctgccagcctgtg
ttgaacagctaccagttccacatcgtcaatggcgcagtggtttgtggatgcacccttggt
cctggtgccagctgccactgcaggctgaaggcctgtgagtgtgacaagcaatccgtgcac
tgcttcaaagagagcctgcccacctatgagaaaaacttcaagcagttctccagccagccc
aggtgtggcagacataagccctggtgctag

KEGG   Homo sapiens (human): 50487
Entry
50487             CDS       T01001                                 
Symbol
PLA2G3, GIII-SPLA2, SPLA2III, sPLA2-III
Name
(RefSeq) phospholipase A2 group III
  KO
K01047  secretory phospholipase A2 [EC:3.1.1.4]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00564  Glycerophospholipid metabolism
hsa00565  Ether lipid metabolism
hsa00590  Arachidonic acid metabolism
hsa00591  Linoleic acid metabolism
hsa00592  alpha-Linolenic acid metabolism
hsa01100  Metabolic pathways
hsa04014  Ras signaling pathway
hsa04270  Vascular smooth muscle contraction
hsa04972  Pancreatic secretion
hsa04975  Fat digestion and absorption
Drug target
Varespladib (DG01394): D06283
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    50487 (PLA2G3)
   00565 Ether lipid metabolism
    50487 (PLA2G3)
   00590 Arachidonic acid metabolism
    50487 (PLA2G3)
   00591 Linoleic acid metabolism
    50487 (PLA2G3)
   00592 alpha-Linolenic acid metabolism
    50487 (PLA2G3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    50487 (PLA2G3)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    50487 (PLA2G3)
  09154 Digestive system
   04972 Pancreatic secretion
    50487 (PLA2G3)
   04975 Fat digestion and absorption
    50487 (PLA2G3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    50487 (PLA2G3)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     50487 (PLA2G3)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation proteins
   Centriole proteins
    50487 (PLA2G3)
SSDB
Motif
Pfam: Phospholip_A2_2 Chromadorea_ALT
Other DBs
NCBI-GeneID: 50487
NCBI-ProteinID: NP_056530
OMIM: 611651
HGNC: 17934
Ensembl: ENSG00000100078
Pharos: Q9NZ20(Tbio)
UniProt: Q9NZ20
LinkDB
Position
22:complement(31134807..31140508)
AA seq 509 aa
MGVQAGLFGMLGFLGVALGGSPALRWYRTSCHLTKAVPGNPLGYLSFLAKDAQGLALIHA
RWDAHRRLQSCSWEDEPELTAAYGALCAHETAWGSFIHTPGPELQRALATLQSQWEACRA
LEESPAGARKKRAAGQSGVPGGGHQREKRGWTMPGTLWCGVGDSAGNSSELGVFQGPDLC
CREHDRCPQNISPLQYNYGIRNYRFHTISHCDCDTRFQQCLQNQHDSISDIVGVAFFNVL
EIPCFVLEEQEACVAWYWWGGCRMYGTVPLARLQPRTFYNASWSSRATSPTPSSRSPAPP
KPRQKQHLRKGPPHQKGSKRPSKANTTALQDPMVSPRLDVAPTGLQGPQGGLKPQGARWV
CRSFRRHLDQCEHQIGPREIEFQLLNSAQEPLFHCNCTRRLARFLRLHSPPEVTNMLWEL
LGTTCFKLAPPLDCVEGKNCSRDPRAIRVSARHLRRLQQRRHQLQDKGTDERQPWPSEPL
RGPMSFYNQCLQLTQAARRPDRQQKSWSQ
NT seq 1530 nt   +upstreamnt  +downstreamnt
atgggggttcaggcagggctgtttgggatgctgggcttcctgggggtggccctggggggc
tcccctgccctccgctggtacaggacctcctgccacttgaccaaggccgtccctggcaac
ccactggggtacctgagcttcctggccaaggatgctcagggactggccctgatccatgcc
cgctgggatgcgcataggaggctgcagtcatgtagctgggaggatgagccggagctcacc
gcagcctacggtgctctctgtgctcatgagactgcctggggctccttcatccacaccccc
ggacccgagctgcagagagcactggccactcttcagagtcagtgggaggcatgccgagcg
cttgaggagagtccagcaggggccaggaagaagcgagcagcagggcagagtggagtccct
ggtggagggcaccagcgagagaagagaggatggaccatgcctggcacactgtggtgtgga
gttggagattctgctgggaactcctcggagctgggggtcttccagggacctgatctctgt
tgccgggaacatgaccgctgcccacagaacatctcacccttgcagtacaactatggcatc
cgaaactaccgattccacaccatctcccactgtgactgtgacaccaggtttcagcaatgc
ctacagaatcagcacgactccatctcggacatcgtgggcgtggccttcttcaacgtgctg
gagatcccctgctttgtgctggaggagcaggaggcgtgtgtggcgtggtactggtggggc
gggtgtaggatgtacggcacagtgcccctcgctcgcctgcagcccaggaccttctacaat
gcctcctggagctcccgggccacctccccaactcccagctcccggagcccagcccctccc
aagcctcgacagaagcagcaccttcggaaggggccaccacatcagaaagggtccaagcgc
cccagcaaagccaacaccacagccctccaggaccctatggtctctcccaggcttgatgtg
gcccccacaggcctccagggcccacagggtggcctaaaacctcagggtgcccgctgggtc
tgccgcagcttccgccgccacctggaccagtgtgagcaccagattgggccccgggaaatc
gagttccagctgctcaacagcgcccaagagcccctcttccactgcaactgcacgcgccgt
ctggcacgcttcctgaggctccacagcccacccgaggttaccaacatgctttgggagctg
ctgggcacaacctgcttcaagctggcccctccactggactgtgtggaaggcaaaaactgt
tccagagaccctagggccatcagggtgtcagcccggcacttgcggaggcttcagcagagg
cgacaccagctccaggataaaggcacagatgagaggcagccatggccttcagagcccctg
agaggccccatgtcattctacaaccagtgcctgcagctaacccaggcagccaggagaccc
gacaggcagcagaagtcctggagccagtga

KEGG   Homo sapiens (human): 5319
Entry
5319              CDS       T01001                                 
Symbol
PLA2G1B, PLA2, PLA2A, PPLA2
Name
(RefSeq) phospholipase A2 group IB
  KO
K01047  secretory phospholipase A2 [EC:3.1.1.4]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00564  Glycerophospholipid metabolism
hsa00565  Ether lipid metabolism
hsa00590  Arachidonic acid metabolism
hsa00591  Linoleic acid metabolism
hsa00592  alpha-Linolenic acid metabolism
hsa01100  Metabolic pathways
hsa04014  Ras signaling pathway
hsa04270  Vascular smooth muscle contraction
hsa04972  Pancreatic secretion
hsa04975  Fat digestion and absorption
Drug target
Varespladib (DG01394): D06283
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    5319 (PLA2G1B)
   00565 Ether lipid metabolism
    5319 (PLA2G1B)
   00590 Arachidonic acid metabolism
    5319 (PLA2G1B)
   00591 Linoleic acid metabolism
    5319 (PLA2G1B)
   00592 alpha-Linolenic acid metabolism
    5319 (PLA2G1B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    5319 (PLA2G1B)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    5319 (PLA2G1B)
  09154 Digestive system
   04972 Pancreatic secretion
    5319 (PLA2G1B)
   04975 Fat digestion and absorption
    5319 (PLA2G1B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    5319 (PLA2G1B)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     5319 (PLA2G1B)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation proteins
   Centriole proteins
    5319 (PLA2G1B)
SSDB
Motif
Pfam: Phospholip_A2_1 Phospholip_A2_4 Phospholip_A2_2 DUF1644
Other DBs
NCBI-GeneID: 5319
NCBI-ProteinID: NP_000919
OMIM: 172410
HGNC: 9030
Ensembl: ENSG00000170890
Pharos: P04054(Tchem)
UniProt: P04054
Structure
LinkDB
Position
12:complement(120322115..120327779)
AA seq 148 aa
MKLLVLAVLLTVAAADSGISPRAVWQFRKMIKCVIPGSDPFLEYNNYGCYCGLGGSGTPV
DELDKCCQTHDNCYDQAKKLDSCKFLLDNPYTHTYSYSCSGSAITCSSKNKECEAFICNC
DRNAAICFSKAPYNKAHKNLDTKKYCQS
NT seq 447 nt   +upstreamnt  +downstreamnt
atgaaactccttgtgctagctgtgctgctcacagtggccgccgccgacagcggcatcagc
cctcgggccgtgtggcagttccgcaaaatgatcaagtgcgtgatcccggggagtgacccc
ttcttggaatacaacaactacggctgctactgtggcttggggggctcaggcacccccgtg
gatgaactggacaagtgctgccagacacatgacaactgctatgaccaggccaagaagctg
gacagctgtaaatttctgctggacaacccgtacacccacacctattcatactcgtgctct
ggctcggcaatcacctgtagcagcaaaaacaaagagtgtgaggccttcatttgcaactgc
gaccgcaacgctgccatctgcttttcaaaagctccatataacaaggcacacaagaacctg
gacaccaagaagtattgtcagagttga

KEGG   Homo sapiens (human): 5320
Entry
5320              CDS       T01001                                 
Symbol
PLA2G2A, MOM1, PLA2, PLA2B, PLA2L, PLA2S, PLAS1, sPLA2
Name
(RefSeq) phospholipase A2 group IIA
  KO
K01047  secretory phospholipase A2 [EC:3.1.1.4]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00564  Glycerophospholipid metabolism
hsa00565  Ether lipid metabolism
hsa00590  Arachidonic acid metabolism
hsa00591  Linoleic acid metabolism
hsa00592  alpha-Linolenic acid metabolism
hsa01100  Metabolic pathways
hsa04014  Ras signaling pathway
hsa04270  Vascular smooth muscle contraction
hsa04972  Pancreatic secretion
hsa04975  Fat digestion and absorption
Drug target
Varespladib (DG01394): D06283
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    5320 (PLA2G2A)
   00565 Ether lipid metabolism
    5320 (PLA2G2A)
   00590 Arachidonic acid metabolism
    5320 (PLA2G2A)
   00591 Linoleic acid metabolism
    5320 (PLA2G2A)
   00592 alpha-Linolenic acid metabolism
    5320 (PLA2G2A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    5320 (PLA2G2A)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    5320 (PLA2G2A)
  09154 Digestive system
   04972 Pancreatic secretion
    5320 (PLA2G2A)
   04975 Fat digestion and absorption
    5320 (PLA2G2A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    5320 (PLA2G2A)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     5320 (PLA2G2A)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation proteins
   Centriole proteins
    5320 (PLA2G2A)
SSDB
Motif
Pfam: Phospholip_A2_1
Other DBs
NCBI-GeneID: 5320
NCBI-ProteinID: NP_000291
OMIM: 172411
HGNC: 9031
Ensembl: ENSG00000188257
Pharos: P14555(Tchem)
UniProt: P14555 A0A024RA96
Structure
LinkDB
Position
1:complement(19975431..19980434)
AA seq 144 aa
MKTLLLLAVIMIFGLLQAHGNLVNFHRMIKLTTGKEAALSYGFYGCHCGVGGRGSPKDAT
DRCCVTHDCCYKRLEKRGCGTKFLSYKFSNSGSRITCAKQDSCRSQLCECDKAAATCFAR
NKTTYNKKYQYYSNKHCRGSTPRC
NT seq 435 nt   +upstreamnt  +downstreamnt
atgaagaccctcctactgttggcagtgatcatgatctttggcctactgcaggcccatggg
aatttggtgaatttccacagaatgatcaagttgacgacaggaaaggaagccgcactcagt
tatggcttctacggctgccactgtggcgtgggtggcagaggatcccccaaggatgcaacg
gatcgctgctgtgtcactcatgactgttgctacaaacgtctggagaaacgtggatgtggc
accaaatttctgagctacaagtttagcaactcggggagcagaatcacctgtgcaaaacag
gactcctgcagaagtcaactgtgtgagtgtgataaggctgctgccacctgttttgctaga
aacaagacgacctacaataaaaagtaccagtactattccaataaacactgcagagggagc
acccctcgttgctga

KEGG   Homo sapiens (human): 5322
Entry
5322              CDS       T01001                                 
Symbol
PLA2G5, FRFB, GV-PLA2, PLA2-10, hVPLA(2)
Name
(RefSeq) phospholipase A2 group V
  KO
K01047  secretory phospholipase A2 [EC:3.1.1.4]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00564  Glycerophospholipid metabolism
hsa00565  Ether lipid metabolism
hsa00590  Arachidonic acid metabolism
hsa00591  Linoleic acid metabolism
hsa00592  alpha-Linolenic acid metabolism
hsa01100  Metabolic pathways
hsa04014  Ras signaling pathway
hsa04270  Vascular smooth muscle contraction
hsa04972  Pancreatic secretion
hsa04975  Fat digestion and absorption
Disease
H02440  Fleck retina, familial benign
Drug target
Varespladib (DG01394): D06283
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    5322 (PLA2G5)
   00565 Ether lipid metabolism
    5322 (PLA2G5)
   00590 Arachidonic acid metabolism
    5322 (PLA2G5)
   00591 Linoleic acid metabolism
    5322 (PLA2G5)
   00592 alpha-Linolenic acid metabolism
    5322 (PLA2G5)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    5322 (PLA2G5)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    5322 (PLA2G5)
  09154 Digestive system
   04972 Pancreatic secretion
    5322 (PLA2G5)
   04975 Fat digestion and absorption
    5322 (PLA2G5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    5322 (PLA2G5)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     5322 (PLA2G5)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation proteins
   Centriole proteins
    5322 (PLA2G5)
SSDB
Motif
Pfam: Phospholip_A2_1 Phospholip_A2_2
Other DBs
NCBI-GeneID: 5322
NCBI-ProteinID: NP_000920
OMIM: 601192
HGNC: 9038
Ensembl: ENSG00000127472
Pharos: P39877(Tchem)
UniProt: P39877
LinkDB
Position
1:20028408..20091911
AA seq 138 aa
MKGLLPLAWFLACSVPAVQGGLLDLKSMIEKVTGKNALTNYGFYGCYCGWGGRGTPKDGT
DWCCWAHDHCYGRLEEKGCNIRTQSYKYRFAWGVVTCEPGPFCHVNLCACDRKLVYCLKR
NLRSYNPQYQYFPNILCS
NT seq 417 nt   +upstreamnt  +downstreamnt
atgaaaggcctcctcccactggcttggttcctggcttgtagtgtgcctgctgtgcaagga
ggcttgctggacctaaaatcaatgatcgagaaggtgacagggaagaacgccctgacaaac
tacggcttctacggctgttactgcggctggggcggccgaggaacccccaaggatggcacc
gattggtgctgttgggcgcatgaccactgctatgggcggctggaggagaagggctgcaac
attcgcacacagtcctacaaatacagattcgcgtggggcgtggtcacctgcgagcccggg
cccttctgccatgtgaacctctgtgcctgtgaccggaagctcgtctactgcctcaagaga
aacctacggagctacaacccacagtaccaatactttcccaacatcctctgctcctag

KEGG   Homo sapiens (human): 5406
Entry
5406              CDS       T01001                                 
Symbol
PNLIP, PL, PNLIPD, PTL
Name
(RefSeq) pancreatic lipase
  KO
K14073  pancreatic triacylglycerol lipase [EC:3.1.1.3]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00561  Glycerolipid metabolism
hsa01100  Metabolic pathways
hsa04972  Pancreatic secretion
hsa04975  Fat digestion and absorption
hsa04977  Vitamin digestion and absorption
Module
hsa_M00098  Acylglycerol degradation
Disease
H02330  Pancreatic lipase deficiency
Drug target
Cetilistat: D09208<JP>
Orlistat: D04028<US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    5406 (PNLIP)
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    5406 (PNLIP)
   04975 Fat digestion and absorption
    5406 (PNLIP)
   04977 Vitamin digestion and absorption
    5406 (PNLIP)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.3  triacylglycerol lipase
     5406 (PNLIP)
SSDB
Motif
Pfam: Lipase PLAT Abhydrolase_6 Hydrolase_4 Abhydrolase_1
Other DBs
NCBI-GeneID: 5406
NCBI-ProteinID: NP_000927
OMIM: 246600
HGNC: 9155
Ensembl: ENSG00000175535
Pharos: P16233(Tclin)
UniProt: P16233
Structure
LinkDB
Position
10:116545931..116567855
AA seq 465 aa
MLPLWTLSLLLGAVAGKEVCYERLGCFSDDSPWSGITERPLHILPWSPKDVNTRFLLYTN
ENPNNFQEVAADSSSISGSNFKTNRKTRFIIHGFIDKGEENWLANVCKNLFKVESVNCIC
VDWKGGSRTGYTQASQNIRIVGAEVAYFVEFLQSAFGYSPSNVHVIGHSLGAHAAGEAGR
RTNGTIGRITGLDPAEPCFQGTPELVRLDPSDAKFVDVIHTDGAPIVPNLGFGMSQVVGH
LDFFPNGGVEMPGCKKNILSQIVDIDGIWEGTRDFAACNHLRSYKYYTDSIVNPDGFAGF
PCASYNVFTANKCFPCPSGGCPQMGHYADRYPGKTNDVGQKFYLDTGDASNFARWRYKVS
VTLSGKKVTGHILVSLFGNKGNSKQYEIFKGTLKPDSTHSNEFDSDVDVGDLQMVKFIWY
NNVINPTLPRVGASKIIVETNVGKQFNFCSPETVREEVLLTLTPC
NT seq 1398 nt   +upstreamnt  +downstreamnt
atgctgccactttggactctttcactgctgctgggagcagtagcaggaaaagaagtttgc
tacgaaagactcggctgcttcagtgatgactccccatggtcaggaattacggaaagaccc
ctccatatattgccttggtctccaaaagatgtcaacacccgcttcctcctatatactaat
gagaacccaaacaactttcaagaagttgccgcagattcatcaagcatcagtggctccaat
ttcaaaacaaatagaaaaactcgctttattattcatggattcatagacaagggagaagaa
aactggctggccaatgtgtgcaagaatctgttcaaggtggaaagtgtgaactgtatctgt
gtggactggaaaggtggctcccgaactggatacacacaagcctcgcagaacatcaggatc
gtgggagcagaagtggcatattttgttgaatttcttcagtcggcgttcggttactcacct
tccaatgtgcatgtcattggccacagcctgggtgcccacgctgctggggaggctggaagg
agaaccaatgggaccattggacgcatcacagggttggacccagcagaaccttgctttcag
ggcacacctgaattagtccgattggaccccagcgatgccaaatttgtggatgtaattcac
acggatggtgcccccatagtccccaatttggggtttggaatgagccaagtcgtgggccac
ctagatttctttccaaatggaggagtggaaatgcctggatgtaaaaagaacattctctct
cagattgtggacatagacggaatctgggaagggactcgagactttgcggcctgtaatcac
ttaagaagctacaaatattacactgatagcatcgtcaaccctgatggctttgctggattc
ccctgtgcctcttacaacgtcttcactgcaaacaagtgtttcccttgtccaagtggaggc
tgcccacagatgggtcactatgctgatagatatcctgggaaaacaaatgatgtgggccag
aaattttatctagacactggtgatgccagtaattttgcacgttggaggtataaggtatct
gtcacactgtctggaaaaaaggttacaggacacatactagtttctttgttcggaaataaa
ggaaactctaagcagtatgaaattttcaagggcactctcaaaccagatagtactcattcc
aatgaatttgactcagatgtggatgttggggacttgcagatggttaaatttatttggtat
aacaatgtgatcaacccaactttacctagagtgggagcatccaagattatagtggagaca
aatgttggaaaacagttcaacttctgtagtccagaaaccgtcagggaggaagttctgctc
accctcacaccgtgttag

KEGG   Homo sapiens (human): 5407
Entry
5407              CDS       T01001                                 
Symbol
PNLIPRP1, PLRP1
Name
(RefSeq) pancreatic lipase related protein 1
  KO
K14074  pancreatic lipase-related protein 1 [EC:3.1.1.3]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00561  Glycerolipid metabolism
hsa01100  Metabolic pathways
hsa04972  Pancreatic secretion
hsa04975  Fat digestion and absorption
Module
hsa_M00098  Acylglycerol degradation
Drug target
Orlistat: D04028<US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    5407 (PNLIPRP1)
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    5407 (PNLIPRP1)
   04975 Fat digestion and absorption
    5407 (PNLIPRP1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.3  triacylglycerol lipase
     5407 (PNLIPRP1)
SSDB
Motif
Pfam: Lipase PLAT Abhydrolase_6 Palm_thioest Abhydrolase_3 Abhydrolase_1 Lipase_3 LIDHydrolase DUF900 DUF676 Hydrolase_4
Other DBs
NCBI-GeneID: 5407
NCBI-ProteinID: NP_001290064
OMIM: 604422
HGNC: 9156
Ensembl: ENSG00000187021
Pharos: P54315(Tbio)
UniProt: P54315
Structure
LinkDB
Position
10:116590959..116609175
AA seq 467 aa
MLIFWTITLFLLGAAKGKEVCYEDLGCFSDTEPWGGTAIRPLKILPWSPEKIGTRFLLYT
NENPNNFQILLLSDPSTIEASNFQMDRKTRFIIHGFIDKGDESWVTDMCKKLFEVEEVNC
ICVDWKKGSQATYTQAANNVRVVGAQVAQMLDILLTEYSYPPSKVHLIGHSLGAHVAGEA
GSKTPGLSRITGLDPVEASFESTPEEVRLDPSDADFVDVIHTDAAPLIPFLGFGTNQQMG
HLDFFPNGGESMPGCKKNALSQIVDLDGIWAGTRDFVACNHLRSYKYYLESILNPDGFAA
YPCTSYKSFESDKCFPCPDQGCPQMGHYADKFAGRTSEEQQKFFLNTGEASNFARWRYGV
SITLSGRTATGQIKVALFGNKGNTHQYSIFRGILKPGSTHSYEFDAKLDVGTIEKVKFLW
NNNVINPTLPKVGATKITVQKGEEKTVYNFCSEDTVREDTLLTLTPC
NT seq 1404 nt   +upstreamnt  +downstreamnt
atgctgatcttctggacaatcacacttttcctgctgggagcagccaaaggaaaagaagtt
tgctatgaggacctcgggtgcttttctgacactgagccctggggcgggacagcaatcagg
cccctgaaaattctcccctggagccctgagaagatcggcacccgcttcctgctgtacacc
aatgaaaacccaaacaactttcaaattctcctcctctctgatccatcaacaattgaggca
tcaaattttcaaatggacagaaagacccggttcatcatccatggcttcatagacaaagga
gatgagagctgggtgacagacatgtgcaagaaactgttcgaggtggaggaggtgaactgc
atctgcgtggactggaagaagggctcccaagccacctacacacaggctgccaacaacgtg
cgagtggtgggcgcccaggtggcccagatgctcgacatcctcttgacagagtatagctac
cccccttccaaagttcacctcattggccacagcctgggagcccacgtggctggagaggca
ggaagcaagactccaggcctgagcaggattacagggttggatcctgtagaagcaagtttc
gagagtactcctgaagaggtgcgacttgatccctctgatgctgactttgttgatgtgatt
cacacggatgcagctcccctgatcccattcttgggttttggaacgaaccaacagatgggt
catcttgacttcttccccaatggaggagagagcatgccgggatgcaagaagaatgccctg
tctcagatcgtggatctagatggcatctgggcgggaacccgggactttgtggcttgcaat
cacctaagaagctacaagtattacttggaaagcatcctcaatcccgatgggtttgctgca
tatccctgcacttcctacaagtcctttgagtctgacaagtgcttcccgtgtccagatcaa
ggatgcccacagatgggtcactatgctgataaatttgctggcaggacaagtgaagagcag
cagaaattcttcttgaacacaggagaggctagcaatttcgctcgctggagatatggggtt
tccatcacactgtctggaagaacagccactggtcagatcaaagttgctttgtttggaaat
aagggaaacactcaccagtacagtatcttcagggggattctcaaaccaggctcaacccat
tcctatgagtttgatgcaaagctggatgttggaacaattgagaaagtcaagtttctttgg
aataacaatgtgataaatccaaccctccccaaagtgggtgccaccaagatcactgtgcaa
aagggagaagagaagacagtgtacaacttctgtagcgaagacacagtgcgggaagacacg
ctgctcaccctcacgccctgctaa

DBGET integrated database retrieval system