KEGG   Homo sapiens (human): 10563
Entry
10563             CDS       T01001                                 
Symbol
CXCL13, ANGIE, ANGIE2, BCA-1, BCA1, BLC, BLR1L, SCYB13
Name
(RefSeq) C-X-C motif chemokine ligand 13
  KO
K10032  C-X-C motif chemokine 13
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
Network
nt06150  Cytokine-cytokine receptor interaction (viruses)
  Element
N01241  CXCL4/9/10/11/13 to CXCR3/5 signaling
N01244  HSV1 SgG1 to CXCR signaling
N01245  HSV2 SgG2 to CXCR signaling
N01246  VAV CrmB to CXCR signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    10563 (CXCL13)
   04061 Viral protein interaction with cytokine and cytokine receptor
    10563 (CXCL13)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    10563 (CXCL13)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    10563 (CXCL13)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   10563 (CXCL13)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 10563
NCBI-ProteinID: NP_006410
OMIM: 605149
HGNC: 10639
Ensembl: ENSG00000156234
Pharos: O43927(Tbio)
UniProt: O43927 Q53X90
Structure
LinkDB
Position
4:77511753..77611834
AA seq 109 aa
MKFISTSLLLMLLVSSLSPVQGVLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNGC
PRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKRSSSTLPVPVFKRKIP
NT seq 330 nt   +upstreamnt  +downstreamnt
atgaagttcatctcgacatctctgcttctcatgctgctggtcagcagcctctctccagtc
caaggtgttctggaggtctattacacaagcttgaggtgtagatgtgtccaagagagctca
gtctttatccctagacgcttcattgatcgaattcaaatcttgccccgtgggaatggttgt
ccaagaaaagaaatcatagtctggaagaagaacaagtcaattgtgtgtgtggaccctcaa
gctgaatggatacaaagaatgatggaagtattgagaaaaagaagttcttcaactctacca
gttccagtgtttaagagaaagattccctga

KEGG   Homo sapiens (human): 3627
Entry
3627              CDS       T01001                                 
Symbol
CXCL10, C7, IFI10, INP10, IP-10, SCYB10, crg-2, gIP-10, mob-1
Name
(RefSeq) C-X-C motif chemokine ligand 10
  KO
K12671  C-X-C motif chemokine 10
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
hsa04620  Toll-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04623  Cytosolic DNA-sensing pathway
hsa04657  IL-17 signaling pathway
hsa04668  TNF signaling pathway
hsa05160  Hepatitis C
hsa05164  Influenza A
hsa05169  Epstein-Barr virus infection
hsa05171  Coronavirus disease - COVID-19
Network
nt06150  Cytokine-cytokine receptor interaction (viruses)
  Element
N01241  CXCL4/9/10/11/13 to CXCR3/5 signaling
N01243  CXCL10 to KSHV vGPCR signaling
N01244  HSV1 SgG1 to CXCR signaling
N01245  HSV2 SgG2 to CXCR signaling
Disease
H01360  Allergic rhinitis
Drug target
Eldelumab: D10404
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    3627 (CXCL10)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3627 (CXCL10)
   04061 Viral protein interaction with cytokine and cytokine receptor
    3627 (CXCL10)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    3627 (CXCL10)
   04622 RIG-I-like receptor signaling pathway
    3627 (CXCL10)
   04623 Cytosolic DNA-sensing pathway
    3627 (CXCL10)
   04657 IL-17 signaling pathway
    3627 (CXCL10)
   04062 Chemokine signaling pathway
    3627 (CXCL10)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    3627 (CXCL10)
   05171 Coronavirus disease - COVID-19
    3627 (CXCL10)
   05164 Influenza A
    3627 (CXCL10)
   05169 Epstein-Barr virus infection
    3627 (CXCL10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    3627 (CXCL10)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    3627 (CXCL10)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   3627 (CXCL10)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Heparin
  Chemokines
   3627 (CXCL10)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 3627
NCBI-ProteinID: NP_001556
OMIM: 147310
HGNC: 10637
Ensembl: ENSG00000169245
Pharos: P02778(Tbio)
UniProt: P02778
Structure
LinkDB
Position
4:complement(76021118..76023497)
AA seq 98 aa
MNQTAILICCLIFLTLSGIQGVPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRV
EIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP
NT seq 297 nt   +upstreamnt  +downstreamnt
atgaatcaaactgccattctgatttgctgccttatctttctgactctaagtggcattcaa
ggagtacctctctctagaactgtacgctgtacctgcatcagcattagtaatcaacctgtt
aatccaaggtctttagaaaaacttgaaattattcctgcaagccaattttgtccacgtgtt
gagatcattgctacaatgaaaaagaagggtgagaagagatgtctgaatccagaatcgaag
gccatcaagaatttactgaaagcagttagcaaggaaaggtctaaaagatctccttaa

KEGG   Homo sapiens (human): 4283
Entry
4283              CDS       T01001                                 
Symbol
CXCL9, CMK, Humig, MIG, SCYB9, crg-10
Name
(RefSeq) C-X-C motif chemokine ligand 9
  KO
K05416  C-X-C motif chemokine 9
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
hsa04620  Toll-like receptor signaling pathway
Network
nt06150  Cytokine-cytokine receptor interaction (viruses)
  Element
N01241  CXCL4/9/10/11/13 to CXCR3/5 signaling
N01244  HSV1 SgG1 to CXCR signaling
N01245  HSV2 SgG2 to CXCR signaling
Disease
H01360  Allergic rhinitis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    4283 (CXCL9)
   04061 Viral protein interaction with cytokine and cytokine receptor
    4283 (CXCL9)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    4283 (CXCL9)
   04062 Chemokine signaling pathway
    4283 (CXCL9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    4283 (CXCL9)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   4283 (CXCL9)
SSDB
Motif
Pfam: IL8 MRP-S27
Other DBs
NCBI-GeneID: 4283
NCBI-ProteinID: NP_002407
OMIM: 601704
HGNC: 7098
Ensembl: ENSG00000138755
Pharos: Q07325(Tbio)
UniProt: Q07325
LinkDB
Position
4:complement(76001275..76007509)
AA seq 125 aa
MKKSGVLFLLGIILLVLIGVQGTPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEK
IEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSR
QKKTT
NT seq 378 nt   +upstreamnt  +downstreamnt
atgaagaaaagtggtgttcttttcctcttgggcatcatcttgctggttctgattggagtg
caaggaaccccagtagtgagaaagggtcgctgttcctgcatcagcaccaaccaagggact
atccacctacaatccttgaaagaccttaaacaatttgccccaagcccttcctgcgagaaa
attgaaatcattgctacactgaagaatggagttcaaacatgtctaaacccagattcagca
gatgtgaaggaactgattaaaaagtgggagaaacaggtcagccaaaagaaaaagcaaaag
aatgggaaaaaacatcaaaaaaagaaagttctgaaagttcgaaaatctcaacgttctcgt
caaaagaagactacataa

KEGG   Homo sapiens (human): 5196
Entry
5196              CDS       T01001                                 
Symbol
PF4, CXCL4, PF-4, SCYB4
Name
(RefSeq) platelet factor 4
  KO
K05407  platelet factor 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
Network
nt06150  Cytokine-cytokine receptor interaction (viruses)
  Element
N01241  CXCL4/9/10/11/13 to CXCR3/5 signaling
N01242  CXCL4 to KSHV vGPCR signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    5196 (PF4)
   04061 Viral protein interaction with cytokine and cytokine receptor
    5196 (PF4)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    5196 (PF4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    5196 (PF4)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    5196 (PF4)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   5196 (PF4)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Heparin
  Chemokines
   5196 (PF4)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 5196
NCBI-ProteinID: NP_002610
OMIM: 173460
HGNC: 8861
Ensembl: ENSG00000163737
Pharos: P02776(Tbio)
UniProt: P02776
Structure
LinkDB
Position
4:complement(73980811..73982124)
AA seq 101 aa
MSSAAGFCASRPGLLFLGLLLLPLVVAFASAEAEEDGDLQCLCVKTTSQVRPRHITSLEV
IKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES
NT seq 306 nt   +upstreamnt  +downstreamnt
atgagctccgcagccgggttctgcgcctcacgccccgggctgctgttcctggggttgctg
ctcctgccacttgtggtcgccttcgccagcgctgaagctgaagaagatggggacctgcag
tgcctgtgtgtgaagaccacctcccaggtccgtcccaggcacatcaccagcctggaggtg
atcaaggccggaccccactgccccactgcccaactgatagccacgctgaagaatggaagg
aaaatttgcttggacctgcaagccccgctgtacaagaaaataattaagaaacttttggag
agttag

KEGG   Homo sapiens (human): 5197
Entry
5197              CDS       T01001                                 
Symbol
PF4V1, CXCL4L1, CXCL4V1, PF4-ALT, PF4A, SCYB4V1
Name
(RefSeq) platelet factor 4 variant 1
  KO
K05407  platelet factor 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    5197 (PF4V1)
   04061 Viral protein interaction with cytokine and cytokine receptor
    5197 (PF4V1)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    5197 (PF4V1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    5197 (PF4V1)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    5197 (PF4V1)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   5197 (PF4V1)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Heparin
  Chemokines
   5197 (PF4V1)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 5197
NCBI-ProteinID: NP_002611
OMIM: 173461
HGNC: 8862
Ensembl: ENSG00000109272
Pharos: P10720(Tbio)
UniProt: P10720
Structure
LinkDB
Position
4:73853296..73854483
AA seq 104 aa
MSSAARSRLTRATRQEMLFLALLLLPVVVAFARAEAEEDGDLQCLCVKTTSQVRPRHITS
LEVIKAGPHCPTAQLIATLKNGRKICLDLQALLYKKIIKEHLES
NT seq 315 nt   +upstreamnt  +downstreamnt
atgagctccgcagccaggtcccgcctcacccgcgccacccgccaggagatgctgttcttg
gcgttgctgctcctgccagttgtggtcgccttcgccagagctgaagctgaagaagatggg
gacctgcagtgcctgtgtgtgaagaccacctcccaggtccgtcccaggcacatcaccagc
ctggaggtgatcaaggccggaccccactgccccactgcccaactcatagccacgctgaag
aatgggaggaaaatttgcttggatctgcaagccctgctgtacaagaaaatcattaaggaa
catttggagagttag

KEGG   Homo sapiens (human): 6373
Entry
6373              CDS       T01001                                 
Symbol
CXCL11, H174, I-TAC, IP-9, IP9, SCYB11, SCYB9B, b-R1
Name
(RefSeq) C-X-C motif chemokine ligand 11
  KO
K12672  C-X-C motif chemokine 11
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
hsa04620  Toll-like receptor signaling pathway
Network
nt06150  Cytokine-cytokine receptor interaction (viruses)
  Element
N01241  CXCL4/9/10/11/13 to CXCR3/5 signaling
N01244  HSV1 SgG1 to CXCR signaling
N01245  HSV2 SgG2 to CXCR signaling
Disease
H01360  Allergic rhinitis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6373 (CXCL11)
   04061 Viral protein interaction with cytokine and cytokine receptor
    6373 (CXCL11)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    6373 (CXCL11)
   04062 Chemokine signaling pathway
    6373 (CXCL11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    6373 (CXCL11)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   6373 (CXCL11)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 6373
NCBI-ProteinID: NP_005400
OMIM: 604852
HGNC: 10638
Ensembl: ENSG00000169248
Pharos: O14625(Tbio)
UniProt: O14625
Structure
LinkDB
Position
4:complement(76033682..76036070)
AA seq 94 aa
MSVKGMAIALAVILCATVVQGFPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKI
EVIITLKENKGQRCLNPKSKQARLIIKKVERKNF
NT seq 285 nt   +upstreamnt  +downstreamnt
atgagtgtgaagggcatggctatagccttggctgtgatattgtgtgctacagttgttcaa
ggcttccccatgttcaaaagaggacgctgtctttgcataggccctggggtaaaagcagtg
aaagtggcagatattgagaaagcctccataatgtacccaagtaacaactgtgacaaaata
gaagtgattattaccctgaaagaaaataaaggacaacgatgcctaaatcccaaatcgaag
caagcaaggcttataatcaaaaaagttgaaagaaagaatttttaa

DBGET integrated database retrieval system