KEGG   Homo sapiens (human): 10568
Entry
10568             CDS       T01001                                 
Symbol
SLC34A2, NAPI-3B, NAPI-IIb, NPTIIb, PULAM
Name
(RefSeq) solute carrier family 34 member 2
  KO
K14683  solute carrier family 34 (sodium-dependent phosphate cotransporter)
Organism
hsa  Homo sapiens (human)
Pathway
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa04978  Mineral absorption
Disease
H01298  Pulmonary alveolar microlithiasis
Drug target
Lifastuzumab: D11237
Lifastuzumab vedotin: D11238
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    10568 (SLC34A2)
  09154 Digestive system
   04978 Mineral absorption
    10568 (SLC34A2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    10568 (SLC34A2)
   04147 Exosome [BR:hsa04147]
    10568 (SLC34A2)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC34: Type II Na+-phosphate cotransporter
   10568 (SLC34A2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   10568 (SLC34A2)
SSDB
Motif
Pfam: Na_Pi_cotrans
Other DBs
NCBI-GeneID: 10568
NCBI-ProteinID: NP_006415
OMIM: 604217
HGNC: 11020
Ensembl: ENSG00000157765
Pharos: O95436(Tbio)
UniProt: O95436
LinkDB
Position
4:25655851..25678748
AA seq 690 aa
MAPWPELGDAQPNPDKYLEGAAGQQPTAPDKSKETNKTDNTEAPVTKIELLPSYSTATLI
DEPTEVDDPWNLPTLQDSGIKWSERDTKGKILCFFQGIGRLILLLGFLYFFVCSLDILSS
AFQLVGGKMAGQFFSNSSIMSNPLLGLVIGVLVTVLVQSSSTSTSIVVSMVSSSLLTVRA
AIPIIMGANIGTSITNTIVALMQVGDRSEFRRAFAGATVHDFFNWLSVLVLLPVEVATHY
LEIITQLIVESFHFKNGEDAPDLLKVITKPFTKLIVQLDKKVISQIAMNDEKAKNKSLVK
IWCKTFTNKTQINVTVPSTANCTSPSLCWTDGIQNWTMKNVTYKENIAKCQHIFVNFHLP
DLAVGTILLILSLLVLCGCLIMIVKILGSVLKGQVATVIKKTINTDFPFPFAWLTGYLAI
LVGAGMTFIVQSSSVFTSALTPLIGIGVITIERAYPLTLGSNIGTTTTAILAALASPGNA
LRSSLQIALCHFFFNISGILLWYPIPFTRLPIRMAKGLGNISAKYRWFAVFYLIIFFFLI
PLTVFGLSLAGWRVLVGVGVPVVFIIILVLCLRLLQSRCPRVLPKKLQNWNFLPLWMRSL
KPWDAVVSKFTGCFQMRCCCCCRVCCRACCLLCDCPKCCRCSKCCEDLEEAQEGQDVPVK
APETFDNITISREAQGEVPASDSKTECTAL
NT seq 2073 nt   +upstreamnt  +downstreamnt
atggctccctggcctgaattgggagatgcccagcccaaccccgataagtacctcgaaggg
gccgcaggtcagcagcccactgcccctgataaaagcaaagagaccaacaaaacagataac
actgaggcacctgtaaccaagattgaacttctgccgtcctactccacggctacactgata
gatgagcccactgaggtggatgacccctggaacctacccactcttcaggactcggggatc
aagtggtcagagagagacaccaaagggaagattctctgtttcttccaagggattgggaga
ttgattttacttctcggatttctctactttttcgtgtgctccctggatattcttagtagc
gccttccagctggttggaggaaaaatggcaggacagttcttcagcaacagctctattatg
tccaaccctttgttggggctggtgatcggggtgctggtgaccgtcttggtgcagagctcc
agcacctcaacgtccatcgttgtcagcatggtgtcctcttcattgctcactgttcgggct
gccatccccattatcatgggggccaacattggaacgtcaatcaccaacactattgttgcg
ctcatgcaggtgggagatcggagtgagttcagaagagcttttgcaggagccactgtccat
gacttcttcaactggctgtccgtgttggtgctcttgcccgtggaggtggccacccattac
ctcgagatcataacccagcttatagtggagagcttccacttcaagaatggagaagatgcc
ccagatcttctgaaagtcatcactaagcccttcacaaagctcattgtccagctggataaa
aaagttatcagccaaattgcaatgaacgatgaaaaagcgaaaaacaagagtcttgtcaag
atttggtgcaaaacttttaccaacaagacccagattaacgtcactgttccctcgactgct
aactgcacctccccttccctctgttggacggatggcatccaaaactggaccatgaagaat
gtgacctacaaggagaacatcgccaaatgccagcatatctttgtgaatttccacctcccg
gatcttgctgtgggcaccatcttgctcatactctccctgctggtcctctgtggttgcctg
atcatgattgtcaagatcctgggctctgtgctcaaggggcaggtcgccactgtcatcaag
aagaccatcaacactgatttcccctttccctttgcatggttgactggctacctggccatc
ctcgtcggggcaggcatgaccttcatcgtacagagcagctctgtgttcacgtcggccttg
acccccctgattggaatcggcgtgataaccattgagagggcttatccactcacgctgggc
tccaacatcggcaccaccaccaccgccatcctggccgccttagccagccctggcaatgca
ttgaggagttcactccagatcgccctgtgccactttttcttcaacatctccggcatcttg
ctgtggtacccgatcccgttcactcgcctgcccatccgcatggccaaggggctgggcaac
atctctgccaagtatcgctggttcgccgtcttctacctgatcatcttcttcttcctgatc
ccgctgacggtgtttggcctctcgctggccggctggcgggtgctggttggtgtcggggtt
cccgtcgtcttcatcatcatcctggtactgtgcctccgactcctgcagtctcgctgccca
cgcgtcctgccgaagaaactccagaactggaacttcctgccgctgtggatgcgctcgctg
aagccctgggatgccgtcgtctccaagttcaccggctgcttccagatgcgctgctgctgc
tgctgccgcgtgtgctgccgcgcgtgctgcttgctgtgtgactgccccaagtgctgccgc
tgcagcaagtgctgcgaggacttggaggaggcgcaggaggggcaggatgtccctgtcaag
gctcctgagacctttgataacataaccattagcagagaggctcagggtgaggtccctgcc
tcggactcaaagaccgaatgcacggccttgtag

KEGG   Homo sapiens (human): 142680
Entry
142680            CDS       T01001                                 
Symbol
SLC34A3, HHRH, NPTIIc
Name
(RefSeq) solute carrier family 34 member 3
  KO
K14683  solute carrier family 34 (sodium-dependent phosphate cotransporter)
Organism
hsa  Homo sapiens (human)
Pathway
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa04978  Mineral absorption
Disease
H00214  Hypophosphatemic rickets
H02138  Hereditary hypophophatemic rickets with hypercalciuria
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    142680 (SLC34A3)
  09154 Digestive system
   04978 Mineral absorption
    142680 (SLC34A3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    142680 (SLC34A3)
   04147 Exosome [BR:hsa04147]
    142680 (SLC34A3)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC34: Type II Na+-phosphate cotransporter
   142680 (SLC34A3)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   142680 (SLC34A3)
SSDB
Motif
Pfam: Na_Pi_cotrans
Other DBs
NCBI-GeneID: 142680
NCBI-ProteinID: NP_001170787
OMIM: 609826
HGNC: 20305
Ensembl: ENSG00000198569
Pharos: Q8N130(Tbio)
UniProt: Q8N130
LinkDB
Position
9:137229730..137236555
AA seq 599 aa
MPSSLPGSQVPHPTLDAVDLVEKTLRNEGTSSSAPVLEEGDTDPWTLPQLKDTSQPWKEL
RVAGRLRRVAGSVLKACGLLGSLYFFICSLDVLSSAFQLLGSKVAGDIFKDNVVLSNPVA
GLVIGVLVTALVQSSSTSSSIVVSMVAAKLLTVRVSVPIIMGVNVGTSITSTLVSMAQSG
DRDEFQRAFSGSAVHGIFNWLTVLVLLPLESATALLERLSELALGAASLTPRAQAPDILK
VLTKPLTHLIVQLDSDMIMSSATGNATNSSLIKHWCGTTGQPTQENSSCGAFGPCTEKNS
TAPADRLPCRHLFAGTELTDLAVGCILLAGSLLVLCGCLVLIVKLLNSVLRGRVAQVVRT
VINADFPFPLGWLGGYLAVLAGAGLTFALQSSSVFTAAVVPLMGVGVISLDRAYPLLLGS
NIGTTTTALLAALASPADRMLSALQVALIHFFFNLAGILLWYLVPALRLPIPLARHFGVV
TARYRWVAGVYLLLGFLLLPLAAFGLSLAGGMELAAVGGPLVGLVLLVILVTVLQRRRPA
WLPVRLRSWAWLPVWLHSLEPWDRLVTRCCPCNVCSPPKATTKEAYCYENPEILASQQL
NT seq 1800 nt   +upstreamnt  +downstreamnt
atgccgagttcccttcccggcagccaggtcccccaccccactctggacgcggttgaccta
gtggaaaagactctgaggaatgaagggacctccagttctgctccagtcttggaggaaggg
gacacagacccctggaccctccctcagctgaaggacacaagccagccctggaaagagctc
cgcgtggccggcaggctgcgccgcgtggccggcagcgtcctcaaggcctgcgggctcctc
ggcagcctgtacttcttcatctgctctctggacgtcctcagctccgccttccagctgctg
ggcagcaaagtggccggagacatcttcaaggacaacgtggtgctgtccaaccctgtggct
ggactggtcattggcgtgctggtcacagccctggtgcagagttccagcacgtcctcctcc
atcgtggtcagcatggtggctgctaagctgctgactgtccgggtgtctgtgcccatcatc
atgggtgtcaacgtaggcacatccatcaccagcaccctggtctcaatggcgcagtcaggg
gaccgggatgaatttcagagggctttcagcggctcggcggtgcacgggatcttcaactgg
ctcacagtgctggtcctgctgccactggagagcgccacggccctgctggagaggctaagt
gagctagccctgggtgccgccagcctgacacccagggcgcaggcgcccgacatcctcaag
gtgctgacgaagccgctcacacacctcatcgtgcagttggactccgacatgatcatgagc
agtgccacaggcaacgccactaacagcagtctcattaagcactggtgcggcaccacgggg
cagccgacccaggagaacagcagctgtggcgccttcggcccgtgcacagagaagaacagc
acagccccggcggacaggctgccctgccgccacctgtttgcgggcacggagctcacggac
ctggccgtgggctgcatcctgctggccggctccctgctggtgctctgcggctgcctggtc
ctcatagtcaagctgctcaactctgtgctgcgcggccgcgtggcccaggtcgtgaggaca
gtcatcaatgcggacttccccttcccgctgggctggctcggcggctacctggccgtcctc
gcgggcgccggcctgaccttcgcactgcagagcagcagcgtcttcacggcggccgtcgtg
cccctcatgggggtcggggtgatcagtctggaccgggcgtaccccctcttactgggctcc
aacatcggcaccactaccacagccctgctggctgccctggccagccccgcagacaggatg
ctcagcgccctgcaggtcgccctcatccacttcttcttcaacctggccggcatcctgctg
tggtacctggtgcctgcactgcggctgcccatcccgctggccaggcacttcggggtggtg
accgcccgttaccgctgggtggctggggtctacctgctgctcggattcctgctgctgccc
ctggcggccttcgggctctccctggcagggggcatggagctggccgctgtcgggggtccc
ctggtggggctggtgctcctcgtcatcctggttactgtcctgcagcggcgccggccggcc
tggctgcctgtccgcctgcgctcctgggcctggctccccgtctggctccattctctggag
ccctgggaccgcctggtgacccgctgctgcccctgcaacgtctgcagccccccgaaggcc
accaccaaagaggcctactgctacgagaaccctgagatcttggcctcccagcagttgtga

KEGG   Homo sapiens (human): 6569
Entry
6569              CDS       T01001                                 
Symbol
SLC34A1, FRTS2, HCINF2, NAPI-3, NPHLOP1, NPT2, NPTIIa, SLC11, SLC17A2
Name
(RefSeq) solute carrier family 34 member 1
  KO
K14683  solute carrier family 34 (sodium-dependent phosphate cotransporter)
Organism
hsa  Homo sapiens (human)
Pathway
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa04978  Mineral absorption
Disease
H00888  Nephrolithiasis/osteoporosis, hypophosphatemic
H01198  Fanconi renotubular syndrome
H01371  Hypercalcemia infantile
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    6569 (SLC34A1)
  09154 Digestive system
   04978 Mineral absorption
    6569 (SLC34A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    6569 (SLC34A1)
   04147 Exosome [BR:hsa04147]
    6569 (SLC34A1)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC34: Type II Na+-phosphate cotransporter
   6569 (SLC34A1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   6569 (SLC34A1)
SSDB
Motif
Pfam: Na_Pi_cotrans
Other DBs
NCBI-GeneID: 6569
NCBI-ProteinID: NP_003043
OMIM: 182309
HGNC: 11019
Ensembl: ENSG00000131183
Pharos: Q06495(Tbio)
UniProt: Q06495 A0A024R7R9 Q86VN6 Q7Z725
LinkDB
Position
5:177384434..177412021
AA seq 639 aa
MLSYGERLGSPAVSPLPVRGGHVMRGTAFAYVPSPQVLHRIPGTSAYAFPSLGPVALAEH
TCPCGEVLERHEPLPAKLALEEEQKPESRLVPKLRQAGAMLLKVPLMLTFLYLFVCSLDM
LSSAFQLAGGKVAGDIFKDNAILSNPVAGLVVGILVTVLVQSSSTSTSIIVSMVSSGLLE
VSSAIPIIMGSNIGTSVTNTIVALMQAGDRTDFRRAFAGATVHDCFNWLSVLVLLPLEAA
TGYLHHITRLVVASFNIHGGRDAPDLLKIITEPFTKLIIQLDESVITSIATGDESLRNHS
LIQIWCHPDSLQAPTSMSRAEANSSQTLGNATMEKCNHIFVDTGLPDLAVGLILLAGSLV
LLCTCLILLVKMLNSLLKGQVAKVIQKVINTDFPAPFTWVTGYFAMVVGASMTFVVQSSS
VFTSAITPLIGLGVISIERAYPLTLGSNIGTTTTAILAALASPREKLSSAFQIALCHFFF
NISGILLWYPVPCTRLPIRMAKALGKRTAKYRWFAVLYLLVCFLLLPSLVFGISMAGWQV
MVGVGTPFGALLAFVVLINVLQSRSPGHLPKWLQTWDFLPRWMHSLKPLDHLITRATLCC
ARPEPRSPPLPPRVFLEELPPATPSPRLALPAHHNATRL
NT seq 1920 nt   +upstreamnt  +downstreamnt
atgttgtcctacggagagaggctggggtcccctgctgtctccccactcccagtccgtggg
gggcatgtgatgcgagggacggcctttgcctacgtgcccagccctcaggtcctacacagg
atcccggggacctctgcctatgccttccccagcctgggccctgtggcccttgctgagcac
acctgcccctgtggggaggtcctggagcgccatgaaccactgcctgccaagctggccctg
gaggaggagcagaagccagagtccaggctggtccccaagctgcgccaggctggcgccatg
ctgctcaaggtgccactgatgctcaccttcctctacctcttcgtctgctccctggacatg
ctcagctcggccttccagctggctggagggaaggtggctggtgacatcttcaaggataac
gccatcctgtccaacccggtggccgggctggtggtggggatcctggtgaccgtgctggtg
cagagctccagcacctccacatccatcatcgtcagcatggtctcctctggcttgctggag
gtgagctctgccatccccatcatcatgggctccaacatcggcacctctgtcaccaacacc
atcgtggccctgatgcaggcgggggacaggactgacttccggcgggccttcgcgggggcc
acggtgcatgactgctttaactggctgtcagtgctggtcctgctgcccctggaggctgcc
actggctacctgcaccacatcactcgacttgtggtggcctccttcaacatccatggtggc
cgtgatgctcctgacctgctcaagatcatcacagagcccttcacgaagctcatcatccag
ctggacgagtctgtgataaccagcattgccactggtgatgagtccctgaggaaccacagt
ctcatccagatctggtgccacccagactccttacaggctcccacctccatgtccagagca
gaggccaactccagccagacccttggaaatgccaccatggagaaatgcaaccacatcttt
gtggacactggcctaccggacctggctgtggggctcatcctgctggcaggatccctggtg
ctgctgtgcacctgcctcatcctcctagtcaagatgctcaactccctgctcaagggccaa
gtggccaaggtcatccagaaggtcatcaatacggacttccctgcccccttcacctgggtc
acaggctactttgccatggtggtgggcgccagcatgaccttcgtggtccagagcagttct
gtgttcacctcggccatcaccccactcatcggtcttggtgtgatcagcattgagagggcc
tacccgctcacactgggttccaacatcggcaccaccaccacggccatcctggctgccctg
gccagccccagggagaagctgtccagcgctttccagattgccctctgtcacttcttcttc
aacatctcgggtatccttctgtggtacccggtgccctgcacacgcctgcccatccgcatg
gccaaggcgctggggaaacgcacggccaagtaccgctggtttgccgtcctctatctcctt
gtctgcttcctgctgctgccctcactggtgtttggcatctccatggcaggctggcaggtc
atggtaggtgtgggcacgcccttcggggccctgctggccttcgtggtgctcatcaatgtc
ctgcagagtcggagtcccgggcacctgcccaagtggttacagacatgggacttcctgcct
cgctggatgcactccctgaagcccctggaccacctcatcacccgcgccaccctatgctgt
gccaggcctgagccccgctcacccccgctgccccccagggtcttcctggaggagctaccc
cctgccacaccctccccccgtcttgcactgcctgctcaccacaatgccacccgcctctag

DBGET integrated database retrieval system