KEGG   Homo sapiens (human): 10715
Entry
10715             CDS       T01001                                 
Symbol
CERS1, EPM8, GDF-1, GDF1, LAG1, LASS1, UOG1
Name
(RefSeq) ceramide synthase 1
  KO
K04710  sphingoid base N-stearoyltransferase [EC:2.3.1.299]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00600  Sphingolipid metabolism
hsa01100  Metabolic pathways
hsa04071  Sphingolipid signaling pathway
Module
hsa_M00094  Ceramide biosynthesis
hsa_M00099  Sphingosine biosynthesis
Disease
H00810  Progressive myoclonic epilepsy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    10715 (CERS1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    10715 (CERS1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.299  sphingoid base N-stearoyltransferase
     10715 (CERS1)
SSDB
Motif
Pfam: TRAM_LAG1_CLN8
Other DBs
NCBI-GeneID: 10715
NCBI-ProteinID: NP_067090
OMIM: 606919
HGNC: 14253
Ensembl: ENSG00000223802
Pharos: P27544(Tbio)
UniProt: P27544
LinkDB
Position
19:complement(18868545..18896982)
AA seq 350 aa
MAAAGPAAGPTGPEPMPSYAQLVQRGWGSALAAARGCTDCGWGLARRGLAEHAHLAPPEL
LLLALGALGWTALRSAATARLFRPLAKRCCLQPRDAAKMPESAWKFLFYLGSWSYSAYLL
FGTDYPFFHDPPSVFYDWTPGMAVPRDIAAAYLLQGSFYGHSIYATLYMDTWRKDSVVML
LHHVVTLILIVSSYAFRYHNVGILVLFLHDISDVQLEFTKLNIYFKSRGGSYHRLHALAA
DLGCLSFGFSWFWFRLYWFPLKVLYATSHCSLRTVPDIPFYFFFNALLLLLTLMNLYWFL
YIVAFAAKVLTGQVHELKDLREYDTAEAQSLKPSKAEKPLRNGLVKDKRF
NT seq 1053 nt   +upstreamnt  +downstreamnt
atggcggcggcggggcccgcggcggggccgacggggcccgagcccatgccgagctacgcg
cagctagtgcagcgcggctggggcagcgcgctggcggcggcgcggggctgcacggactgc
ggctgggggctggcgcgtcgcggcctggctgagcacgcgcacctggcgccgcccgagctg
ctgctgctggcgctcggcgcgctgggctggaccgccctgcgctccgcggccactgcgcgc
ctctttcggcccctggcgaagcggtgctgcctccagcccagagatgccgccaagatgccc
gagagcgcttggaagtttctcttctacctgggcagctggagctacagtgcctacctgctg
tttggcaccgactaccccttcttccatgacccaccatctgtcttctacgactggacgccg
ggcatggcagtgccacgggacattgcagccgcctacctgctccagggaagcttctatggc
cactccatctacgctacgctatacatggacacctggcgcaaggactcggtggtcatgctg
ctccaccacgtggtcactctcatcctcatcgtctcctcctacgccttccggtaccacaat
gtgggcatccttgtgctcttcctgcacgatatcagtgacgtgcagcttgagttcaccaag
ctcaacatttacttcaagtcccgcggcggctcctaccatcggctgcatgccttggcagca
gacttgggctgcctcagcttcggcttcagctggttctggttccgcctctactggttcccg
ctcaaggtcctgtatgccaccagtcactgcagtctgcgcacggtgcctgacatccccttc
tacttcttcttcaatgcgctcctgctgctgctcacccttatgaacctctactggttcctg
tacatcgtggcgtttgcagccaaggtgttgacaggccaggtgcacgagctgaaggacctg
cgggagtatgacacagccgaggcccagagcctgaagcccagcaaagccgagaagccactg
aggaacggcctggtgaaggacaagcgcttctga

KEGG   Homo sapiens (human): 204219
Entry
204219            CDS       T01001                                 
Symbol
CERS3, ARCI9, LASS3
Name
(RefSeq) ceramide synthase 3
  KO
K24622  very-long-chain ceramide synthase / ultra-long-chain ceramide synthase [EC:2.3.1.297 2.3.1.298]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00600  Sphingolipid metabolism
hsa01100  Metabolic pathways
hsa04071  Sphingolipid signaling pathway
Module
hsa_M00094  Ceramide biosynthesis
hsa_M00099  Sphingosine biosynthesis
Disease
H00734  Autosomal recessive congenital ichthyosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    204219 (CERS3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    204219 (CERS3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.297  very-long-chain ceramide synthase
     204219 (CERS3)
    2.3.1.298  ultra-long-chain ceramide synthase
     204219 (CERS3)
SSDB
Motif
Pfam: TRAM_LAG1_CLN8 Homeodomain Homez DUF1003
Other DBs
NCBI-GeneID: 204219
NCBI-ProteinID: NP_001277271
OMIM: 615276
HGNC: 23752
Ensembl: ENSG00000154227
Pharos: Q8IU89(Tbio)
UniProt: Q8IU89
LinkDB
Position
15:complement(100400395..100544683)
AA seq 383 aa
MFWTFKEWFWLERFWLPPTIKWSDLEDHDGLVFVKPSHLYVTIPYAFLLLIIRRVFEKFV
ASPLAKSFGIKETVRKVTPNTVLENFFKHSTRQPLQTDIYGLAKKCNLTERQVERWFRSR
RNQERPSRLKKFQEACWRFAFYLMITVAGIAFLYDKPWLYDLWEVWNGYPKQPLLPSQYW
YYILEMSFYWSLLFRLGFDVKRKDFLAHIIHHLAAISLMSFSWCANYIRSGTLVMIVHDV
ADIWLESAKMFSYAGWTQTCNTLFFIFSTIFFISRLIVFPFWILYCTLILPMYHLEPFFS
YIFLNLQLMILQVLHLYWGYYILKMLNRCIFMKSIQDVRSDDEDYEEEEEEEEEEATKGK
EMDCLKNGLRAERHLIPNGQHGH
NT seq 1152 nt   +upstreamnt  +downstreamnt
atgttttggacgtttaaagaatggttctggttggaaagattctggcttcctccaacaata
aagtggtcagatcttgaggatcacgatggactcgtctttgtaaaaccttctcatttatac
gtgacaattccatatgcttttctcttgctgattatcagacgtgtatttgaaaaatttgtt
gcttcacctctagcaaaatcatttggcattaaagagacagttcgaaaggttacaccaaat
actgtcttagagaattttttcaaacattccacaaggcaaccattgcaaactgatatttat
ggactggcaaagaagtgtaacttgacggagcgccaggtggaaagatggtttaggagtcgg
cggaatcaagagaggccttccaggctgaagaaattccaggaagcttgctggagatttgca
ttttacttaatgatcactgttgctggaattgcgtttctttatgataaaccttggctatat
gacttatgggaggtttggaatggctatcccaaacagcccctgctgccatcccagtactgg
tactacattttagaaatgagtttttattggtctctgttatttagacttggctttgatgtc
aagagaaaggattttctagctcatatcatccaccacctggctgctattagtctgatgagc
ttctcttggtgtgctaattatattcgcagtgggaccctcgtgatgattgtacacgatgtg
gctgacatttggctggagtctgctaagatgttttcttatgctggatggacgcagacctgt
aacaccctgtttttcatcttctccaccatatttttcatcagccgcctcattgtttttcct
ttctggattttatattgcacgctgatcttgcctatgtatcacctcgagcctttcttttca
tacatcttcctcaacctacagctcatgatcttgcaggtccttcacctttactggggttat
tacatcttgaagatgctcaacagatgtatattcatgaagagcatccaggatgtgaggagt
gatgacgaggattatgaagaggaagaggaagaggaagaagaagaggctaccaaaggcaaa
gagatggattgtttaaagaacggcctcagggctgagaggcacctcattcccaatggccag
catggccattag

KEGG   Homo sapiens (human): 253782
Entry
253782            CDS       T01001                                 
Symbol
CERS6, CERS5, LASS6
Name
(RefSeq) ceramide synthase 6
  KO
K23727  sphingoid base N-palmitoyltransferase [EC:2.3.1.291]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00600  Sphingolipid metabolism
hsa01100  Metabolic pathways
hsa04071  Sphingolipid signaling pathway
Module
hsa_M00094  Ceramide biosynthesis
hsa_M00099  Sphingosine biosynthesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    253782 (CERS6)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    253782 (CERS6)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.291  sphingoid base N-palmitoyltransferase
     253782 (CERS6)
SSDB
Motif
Pfam: TRAM_LAG1_CLN8 Homeodomain DUF5931
Other DBs
NCBI-GeneID: 253782
NCBI-ProteinID: NP_982288
OMIM: 615336
HGNC: 23826
Ensembl: ENSG00000172292
Pharos: Q6ZMG9(Tbio)
UniProt: Q6ZMG9
LinkDB
Position
2:168456272..168775134
AA seq 384 aa
MAGILAWFWNERFWLPHNVTWADLKNTEEATFPQAEDLYLAFPLAFCIFMVRLIFERFVA
KPCAIALNIQANGPQIAPPNAILEKVFTAITKHPDEKRLEGLSKQLDWDVRSIQRWFRQR
RNQEKPSTLTRFCESMWRFSFYLYVFTYGVRFLKKTPWLWNTRHCWYNYPYQPLTTDLHY
YYILELSFYWSLMFSQFTDIKRKDFGIMFLHHLVSIFLITFSYVNNMARVGTLVLCLHDS
ADALLEAAKMANYAKFQKMCDLLFVMFAVVFITTRLGIFPLWVLNTTLFESWEIVGPYPS
WWVFNLLLLLVQGLNCFWSYLIVKIACKAVSRGKVSKDDRSDIESSSDEEDSEPPGKNPH
TATTTNGTSGTNGYLLTGSCSMDD
NT seq 1155 nt   +upstreamnt  +downstreamnt
atggcagggatcttagcctggttctggaacgagaggttttggctcccgcacaatgtcacc
tgggcggacctgaagaacacggaggaggccaccttcccgcaggctgaggacctctatctc
gcttttcccctggccttctgtatcttcatggtgcggctcatcttcgagagatttgtagcc
aaaccgtgcgccatagccctcaacattcaggccaatggaccacaaattgctccgcccaat
gccattctggaaaaggtcttcactgcaattacaaagcatcctgatgaaaagagattggaa
ggcctctccaagcaactggactgggatgttcgaagcattcagcgctggtttcgacaaaga
cgcaatcaggagaagccaagcacgctgacgaggttctgtgagagcatgtggagattttca
ttttacctttatgtatttacctacggagtcagattcctgaaaaagaccccctggttgtgg
aatacgaggcattgctggtacaactacccctatcagccactcacaactgaccttcactac
tattacatcctggagctgtcgttttattggtctttgatgttttctcagttcactgatatc
aaaagaaaggactttggcattatgttcctgcaccaccttgtatctattttcttgattacc
ttttcatatgtcaacaatatggcccgagtaggaacgctggtcctttgtcttcatgattca
gctgatgctcttctggaggctgccaaaatggcaaattatgccaagtttcagaaaatgtgt
gatctcctgtttgttatgtttgccgtggtttttatcaccacacgactgggtatatttcct
ctctgggtgttaaataccacattatttgaaagctgggagatcgttggaccttacccttcc
tggtgggtttttaacctactgctattgctagtacaagggttgaactgcttctggtcttac
ttgattgtgaaaatagcttgcaaagctgtttcaagaggcaaggtgtccaaggatgatcga
agtgatattgagtctagctcagatgaggaggactcagaacctccgggaaagaatccccac
actgcgacaaccaccaatgggaccagtggtaccaacgggtatctcctgactggctcctgc
tccatggatgattaa

KEGG   Homo sapiens (human): 29956
Entry
29956             CDS       T01001                                 
Symbol
CERS2, L3, LASS2, SP260, TMSG1
Name
(RefSeq) ceramide synthase 2
  KO
K24621  very-long-chain ceramide synthase [EC:2.3.1.297]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00600  Sphingolipid metabolism
hsa01100  Metabolic pathways
hsa04071  Sphingolipid signaling pathway
Module
hsa_M00094  Ceramide biosynthesis
hsa_M00099  Sphingosine biosynthesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    29956 (CERS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    29956 (CERS2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.297  very-long-chain ceramide synthase
     29956 (CERS2)
SSDB
Motif
Pfam: TRAM_LAG1_CLN8 Homeodomain Homez TRAM1
Other DBs
NCBI-GeneID: 29956
NCBI-ProteinID: NP_071358
OMIM: 606920
HGNC: 14076
Ensembl: ENSG00000143418
Pharos: Q96G23(Tbio)
UniProt: Q96G23
LinkDB
Position
1:complement(150965186..150974835)
AA seq 380 aa
MLQTLYDYFWWERLWLPVNLTWADLEDRDGRVYAKASDLYITLPLALLFLIVRYFFELYV
ATPLAALLNIKEKTRLRAPPNATLEHFYLTSGKQPKQVEVELLSRQSGLSGRQVERWFRR
RRNQDRPSLLKKFREASWRFTFYLIAFIAGMAVIVDKPWFYDMKKVWEGYPIQSTIPSQY
WYYMIELSFYWSLLFSIASDVKRKDFKEQIIHHVATIILISFSWFANYIRAGTLIMALHD
SSDYLLESAKMFNYAGWKNTCNNIFIVFAIVFIITRLVILPFWILHCTLVYPLELYPAFF
GYYFFNSMMGVLQLLHIFWAYLILRMAHKFITGKLVEDERSDREETESSEGEEAAAGGGA
KSRPLANGHPILNNNHRKND
NT seq 1143 nt   +upstreamnt  +downstreamnt
atgctccagaccttgtatgattacttctggtgggaacgtctgtggctgcctgtgaacttg
acctgggccgatctagaagaccgagatggacgtgtctacgccaaagcctcagatctctat
atcacgctgcccctggccttgctcttcctcatcgttcgatacttctttgagctgtacgtg
gctacaccactggctgccctcttgaacataaaggagaaaactcggctgcgggcacctccc
aacgccaccttggaacatttctacctgaccagtggcaagcagcccaagcaggtggaagta
gagcttttgtcccggcagagcgggctctctggccgccaggtagagcgttggttccgtcgc
cgccgcaaccaggaccggcccagtctcctcaagaagttccgagaagccagctggagattc
acattttacctgattgccttcattgccggcatggccgtcattgtggataaaccctggttc
tatgacatgaagaaagtttgggagggatatcccatacagagcactatcccttcccagtat
tggtactacatgattgaactttccttctactggtccctgctcttcagcattgcctctgat
gtcaagcgaaaggatttcaaggaacagatcatccaccatgtggccaccatcattctcatc
agcttttcctggtttgccaattacatccgagctgggactctaatcatggctctgcatgac
tcttccgattacctgctggagtcagccaagatgtttaactacgcgggatggaagaacacc
tgcaacaacatcttcatcgtcttcgccattgtttttatcatcacccgactggtcatcctg
cccttctggatcctgcattgcaccctggtgtacccactggagctctatcctgccttcttt
ggctattacttcttcaattccatgatgggagttctacagctgctgcatatcttctgggcc
tacctcattttgcgcatggcccacaagttcataactggaaagctggtagaagatgaacgc
agtgaccgggaagaaacagagagctcagagggggaggaggctgcagctgggggaggagca
aagagccggcccctagccaatggccaccccatcctcaataacaaccatcgtaagaatgac
tga

KEGG   Homo sapiens (human): 79603
Entry
79603             CDS       T01001                                 
Symbol
CERS4, LASS4, Trh1
Name
(RefSeq) ceramide synthase 4
  KO
K24621  very-long-chain ceramide synthase [EC:2.3.1.297]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00600  Sphingolipid metabolism
hsa01100  Metabolic pathways
hsa04071  Sphingolipid signaling pathway
Module
hsa_M00094  Ceramide biosynthesis
hsa_M00099  Sphingosine biosynthesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    79603 (CERS4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    79603 (CERS4)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.297  very-long-chain ceramide synthase
     79603 (CERS4)
SSDB
Motif
Pfam: TRAM_LAG1_CLN8 Homeodomain
Other DBs
NCBI-GeneID: 79603
NCBI-ProteinID: NP_078828
OMIM: 615334
HGNC: 23747
Ensembl: ENSG00000090661
Pharos: Q9HA82(Tbio)
UniProt: Q9HA82 Q53HF9
LinkDB
Position
19:8209370..8262421
AA seq 394 aa
MLSSFNEWFWQDRFWLPPNVTWTELEDRDGRVYPHPQDLLAALPLALVLLAMRLAFERFI
GLPLSRWLGVRDQTRRQVKPNATLEKHFLTEGHRPKEPQLSLLAAQCGLTLQQTQRWFRR
RRNQDRPQLTKKFCEASWRFLFYLSSFVGGLSVLYHESWLWAPVMCWDRYPNQTLKPSLY
WWYLLELGFYLSLLIRLPFDVKRKDFKEQVIHHFVAVILMTFSYSANLLRIGSLVLLLHD
SSDYLLEACKMVNYMQYQQVCDALFLIFSFVFFYTRLVLFPTQILYTTYYESISNRGPFF
GYYFFNGLLMLLQLLHVFWSCLILRMLYSFMKKGQMEKDIRSDVEESDSSEEAAAAQEPL
QLKNGAAGGPRPAPTDGPRSRVAGRLTNRHTTAT
NT seq 1185 nt   +upstreamnt  +downstreamnt
atgctgtccagtttcaacgagtggttttggcaggacaggttctggttaccacccaatgtc
acgtggacagagctagaagaccgggatggccgtgtctacccccacccccaggacttgttg
gcagccctgcccctggcgctggtcctcctggccatgcgccttgcctttgagagattcatt
ggcctgcccctgagccggtggctgggtgtgagggatcagaccaggaggcaagtgaagccc
aacgccacgctggagaaacacttcctcacggaagggcacaggcccaaggagccccagctg
tctctcctggccgcccagtgtggcctcacgctgcagcagacccagcgatggttccggaga
cgccggaaccaggatcgaccccagctgaccaagaagttctgtgaggccagctggaggttt
ctcttctacctgtcctccttcgtgggcggcctctcggtcctgtaccacgagtcatggctg
tgggcaccagtaatgtgctgggacaggtacccaaaccagactctgaagccatccctgtac
tggtggtacctcttggagctgggtttctacctctcactgctaatcaggctgccctttgat
gtcaagcgcaaggatttcaaggagcaggtgatacaccacttcgtggcggtcatcctgatg
accttctcctacagtgccaacctgctgcgcattggctctctggtgctgctgttacacgat
tcctctgactacctgctggaggcctgtaagatggtcaactacatgcagtatcagcaagtg
tgcgacgctctcttcctcatcttctcctttgtcttcttctacacccgactggtcctcttt
cccacccagatcctctacaccacatactacgagtccatcagcaacaggggccccttcttc
ggctactacttcttcaacgggcttctgatgttgctgcagctgctgcacgtgttctggtct
tgcctcattctgcgcatgctctatagcttcatgaagaagggccagatggagaaggacatt
cgtagtgatgtagaagaatcagactccagtgaggaggcggcggcggcccaggaacctctg
cagctaaagaacggggcagctggagggcccaggccagcccccactgatggccctcggagc
cgggtggccgggcgtctgaccaacaggcacacaacagccacatag

KEGG   Homo sapiens (human): 91012
Entry
91012             CDS       T01001                                 
Symbol
CERS5, LASS5, Trh4
Name
(RefSeq) ceramide synthase 5
  KO
K23727  sphingoid base N-palmitoyltransferase [EC:2.3.1.291]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00600  Sphingolipid metabolism
hsa01100  Metabolic pathways
hsa04071  Sphingolipid signaling pathway
Module
hsa_M00094  Ceramide biosynthesis
hsa_M00099  Sphingosine biosynthesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    91012 (CERS5)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    91012 (CERS5)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.291  sphingoid base N-palmitoyltransferase
     91012 (CERS5)
SSDB
Motif
Pfam: TRAM_LAG1_CLN8 Homeodomain
Other DBs
NCBI-GeneID: 91012
NCBI-ProteinID: NP_671723
OMIM: 615335
HGNC: 23749
Ensembl: ENSG00000139624
Pharos: Q8N5B7(Tbio)
UniProt: Q8N5B7
LinkDB
Position
12:complement(50129289..50167369)
AA seq 392 aa
MATAAQGPLSLLWGWLWSERFWLPENVSWADLEGPADGYGYPRGRHILSVFPLAAGIFFV
RLLFERFIAKPCALCIGIEDSGPYQAQPNAILEKVFISITKYPDKKRLEGLSKQLDWNVR
KIQCWFRHRRNQDKPPTLTKFCESMWRFTFYLCIFCYGIRFLWSSPWFWDIRQCWHNYPF
QPLSSGLYHYYIMELAFYWSLMFSQFTDIKRKDFLIMFVHHLVTIGLISFSYINNMVRVG
TLIMCLHDVSDFLLEAAKLANYAKYQRLCDTLFVIFSAVFMVTRLGIYPFWILNTTLFES
WEIIGPYASWWLLNGLLLTLQLLHVIWSYLIARIALKALIRGKVSKDDRSDVESSSEEED
VTTCTKSPCDSSSSNGANRVNGHMGGSYWAEE
NT seq 1179 nt   +upstreamnt  +downstreamnt
atggcgacagcagcgcagggacccctaagcttgctgtggggctggctgtggagcgagcgc
ttctggctacccgagaacgtgagctgggctgatctggaggggccggccgacggctacggt
tacccccgcggccggcacatcctctcggtgttcccgctggcggcgggcatcttcttcgtg
aggctgctcttcgagcgatttattgccaaaccctgtgcactctgtattggcatcgaggac
agtggtccttatcaggcccaacccaatgccatccttgaaaaggtgttcatatctattacc
aagtatcctgataagaaaaggctggagggcctgtcaaagcagctggattggaatgtccga
aaaatccaatgctggtttcgccatcggaggaatcaggacaagcccccaacgcttactaaa
ttctgtgaaagcatgtggagattcacattttatttatgtatattctgctatggaattaga
tttctctggtcgtcaccttggttctgggacatccgacagtgctggcataactatccattt
cagcctctttcaagtgggctttatcactattatatcatggaattggccttctattggtcc
cttatgttttctcagtttacagacattaaaagaaaggacttcctgatcatgtttgtgcat
cacttggtcaccattgggcttatctccttctcctacatcaacaatatggttcgagtggga
actctgatcatgtgtctacatgatgtctcagacttcttgctggaggcagccaaactggcc
aattatgccaagtatcagcggctctgtgacaccctttttgtgatcttcagtgctgttttt
atggttacacgactaggaatctatccattctggattctgaacacgaccctctttgagagt
tgggagataatcgggccttatgcttcatggtggctcctcaatggcctgctgctgacccta
cagcttctgcatgtcatctggtcctacctaattgcacggattgctttgaaagccttgatc
aggggaaaggtatcgaaggatgatcgcagtgatgtggagagcagctcagaggaagaagat
gtgaccacctgcacaaaaagtccctgtgacagtagctccagcaatggtgccaatcgggtg
aatggtcacatgggaggcagctactgggctgaagagtaa

DBGET integrated database retrieval system