KEGG   Homo sapiens (human): 10788
Entry
10788             CDS       T01001                                 

Gene name
IQGAP2
Definition
(RefSeq) IQ motif containing GTPase activating protein 2
  KO
K05767  Ras GTPase-activating-like protein IQGAP2/3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    10788 (IQGAP2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    10788 (IQGAP2)
   04147 Exosome [BR:hsa04147]
    10788 (IQGAP2)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     10788 (IQGAP2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   10788 (IQGAP2)
  Exosomal proteins of colorectal cancer cells
   10788 (IQGAP2)
SSDB
Motif
Pfam: RasGAP RasGAP_C CH IQ
Other DBs
NCBI-GeneID: 10788
NCBI-ProteinID: NP_006624
OMIM: 605401
HGNC: 6111
Ensembl: ENSG00000145703
Vega: OTTHUMG00000162432
Pharos: Q13576(Tbio)
UniProt: Q13576 B7Z7U6 Q59HA3
LinkDB
Structure
PDB: 
4EZA 3IEZ 5CJP

Position
5q13.3
AA seq 1575 aa
MPHEELPSLQRPRYGSIVDDERLSAEEMDERRRQNIAYEYLCHLEEAKRWMEVCLVEELP
PTTELEEGLRNGVYLAKLAKFFAPKMVSEKKIYDVEQTRYKKSGLHFRHTDNTVQWLRAM
ESIGLPKIFYPETTDVYDRKNIPRMIYCIHALSLYLFKLGIAPQIQDLLGKVDFTEEEIS
NMRKELEKYGIQMPSFSKIGGILANELSVDEAALHAAVIAINEAVEKGIAEQTVVTLRNP
NAVLTLVDDNLAPEYQKELWDAKKKKEENARLKNSCISEEERDAYEELLTQAEIQGNINK
VNRQAAVDHINAVIPEGDPENTLLALKKPEAQLPAVYPFAAAMYQNELFNLQKQNTMNYL
AHEELLIAVEMLSAVALLNQALESNDLVSVQNQLRSPAIGLNNLDKAYVERYANTLLSVK
LEVLSQGQDNLSWNEIQNCIDMVNAQIQEENDRVVAVGYINEAIDEGNPLRTLETLLLPT
ANISDVDPAHAQHYQDVLYHAKSQKLGDSESVSKVLWLDEIQQAVDDANVDKDRAKQWVT
LVVDVNQCLEGKKSSDILSVLKSSTSNANDIIPECADKYYDALVKAKELKSERVSSDGSW
LKLNLHKKYDYYYNTDSKESSWVTPESCLYKESWLTGKEIEDIIEEVTVGYIRENIWSAS
EELLLRFQATSSGPILREEFEARKSFLHEQEENVVKIQAFWKGYKQRKEYMHRRQTFIDN
TDSIVKIQSWFRMATARKSYLSRLQYFRDHNNEIVKIQSLLRANKARDDYKTLVGSENPP
LTVIRKFVYLLDQSDLDFQEELEVARLREEVVTKIRANQQLEKDLNLMDIKIGLLVKNRI
TLEDVISHSKKLNKKKGGEMEILNNTDNQGIKSLSKERRKTLETYQQLFYLLQTNPLYLA
KLIFQMPQNKSTKFMDTVIFTLYNYASNQREEYLLLKLFKTALEEEIKSKVDQVQDIVTG
NPTVIKMVVSFNRGARGQNTLRQLLAPVVKEIIDDKSLIINTNPVEVYKAWVNQLETQTG
EASKLPYDVTTEQALTYPEVKNKLEASIENLRRVTDKVLNSIISSLDLLPYGLRYIAKVL
KNSIHEKFPDATEDELLKIVGNLLYYRYMNPAIVAPDGFDIIDMTAGGQINSDQRRNLGS
VAKVLQHAASNKLFEGENEHLSSMNNYLSETYQEFRKYFKEACNVPEPEEKFNMDKYTDL
VTVSKPVIYISIEEIISTHSLLLEHQDAIAPEKNDLLSELLGSLGEVPTVESFLGEGAVD
PNDPNKANTLSQLSKTEISLVLTSKYDIEDGEAIDSRSLMIKTKKLIIDVIRNQPGNTLT
EILETPATAQQEVDHATDMVSRAMIDSRTPEEMKHSQSMIEDAQLPLEQKKRKIQRNLRT
LEQTGHVSSENKYQDILNEIAKDIRNQRIYRKLRKAELAKLQQTLNALNKKAAFYEEQIN
YYDTYIKTCLDNLKRKNTRRSIKLDGKGEPKGAKRAKPVKYTAAKLHEKGVLLDIDDLQT
NQFKNVTFDIIATEDVGIFDVRSKFLGVEMEKVQLNIQDLLQMQYEGVAVMKMFDKVKVN
VNLLIYLLNKKFYGK
NT seq 4728 nt   +upstreamnt  +downstreamnt
atgccacacgaagagctgccgtcgctgcagagaccccgctatggctctattgtggacgat
gaaaggctctctgcagaggagatggatgagaggaggcggcagaacattgcttatgaatat
ctgtgccacttagaggaagccaaaaggtggatggaagtttgcttagttgaagaattgcca
ccaaccactgaattggaagaagggctccggaatggagtttaccttgcaaagttagccaag
ttctttgccccgaaaatggtatcagagaaaaagatctatgatgtggaacaaacacgttat
aagaagtctggccttcattttcgacacacagataataccgtccagtggttaagagcgatg
gagtctattggtctacccaagatattttatccagaaacaacagatgtctatgatcggaaa
aacataccaagaatgatatattgcattcacgcactgagtttgtatctgttcaaactagga
atagcaccccagatccaggatttgttgggcaaagtagacttcacagaggaggaaatcagt
aatatgagaaaagaacttgagaaatatggaatacagatgccatctttcagcaaaataggt
ggtattctggccaatgaactgtccgtggatgaagctgcattacatgctgcagttatagcc
attaatgaagcagttgaaaaaggaatagcagagcaaaccgttgtaacactaagaaaccca
aatgcggttttaactttagtggatgacaaccttgcaccagaatatcagaaagaactctgg
gatgccaaaaagaaaaaagaggaaaatgcaagactgaagaatagctgtatttcagaagaa
gaaagagatgcttatgaagaactgctgacacaagcagaaatccaaggcaatattaataaa
gtcaacaggcaggctgcagtggaccatatcaatgctgtcattccggaaggtgaccccgag
aatacgctgcttgcactgaagaaaccagaggcccagctgcctgctgtttatccctttgct
gctgccatgtatcagaacgaacttttcaacctccagaaacagaacaccatgaactacttg
gcccacgaggagcttttgattgctgtggaaatgttgtctgctgttgctttactaaaccag
gccttggaaagcaacgatcttgtgtctgtgcagaatcaactcagaagccccgcaataggc
ttaaacaatctggacaaggcatatgtggaacgttatgcaaacacactactctctgttaaa
ctagaagttttatcccaagggcaagataacttaagctggaatgaaattcagaattgtatt
gatatggttaatgctcaaattcaagaagaaaatgaccgagttgtagctgtagggtacatc
aatgaagctattgatgaagggaatcctttgaggactttagaaactttgctcctacctact
gcgaatattagtgatgtggacccagcccatgcccagcactaccaggatgttttataccat
gctaaatcacagaaactcggagactctgagagtgtttccaaagtgctttggctggatgag
atacagcaagccgtcgatgatgccaacgtggacaaggacagagcaaaacaatgggttact
ctggtggttgatgttaatcagtgtttggaaggaaaaaaatcaagtgatattttgtctgta
ttgaagtcttccacttctaatgcaaatgacataatcccggagtgtgctgacaaatactat
gatgcccttgtgaaggcaaaagagctcaaatctgaaagagtgtctagtgacggttcatgg
ctcaaactcaacctgcacaaaaaatatgactactattacaacactgattcaaaagagagt
tcctgggtcacacctgaatcatgcttgtataaagaatcatggctcacaggaaaagaaatc
gaggacattattgaggaagtcacagtaggttacattcgtgagaatatatggtctgcttca
gaagagttgcttcttcgctttcaagccacaagctcaggacccatccttagggaagagttt
gaagctagaaaatcatttttgcatgaacaagaagagaatgtggtcaaaatacaggctttt
tggaaaggatataaacaacggaaggagtatatgcacaggcggcaaacgttcattgataat
actgattctattgtgaagattcagtcctggttccgaatggcaactgcaagaaagagctat
ctttcaagactacagtatttcagagatcataataatgaaattgtgaaaatacagtcactg
ttgagagcgaacaaagctagagatgactacaaaacattggttggctctgaaaacccacca
ttaacagtaattcgcaaatttgtatacctgctggaccaaagtgatttggatttccaggag
gaactagaggttgcacgattaagggaagaagtagtgaccaagatcagggccaatcaacag
ctggaaaaagacctgaacctgatggacatcaagattggactgctggtgaagaacaggatc
acactagaggatgtaatttcacatagtaaaaagctgaacaagaaaaaaggaggagaaatg
gaaatactgaataacaccgacaaccaaggaataaaaagtttgagtaaggagaggagaaaa
acactagaaacatatcagcagctgttttaccttttacagaccaaccctttatacttggct
aagctgattttccagatgccacagaacaagtccactaaatttatggatactgttattttc
acactatataattatgcctctaatcagcgagaagaatatctacttctcaagctttttaaa
actgctctggaggaagaaataaaatcaaaagtggaccaggtacaggacatagttactggt
aaccctacagtcatcaagatggtcgtcagcttcaatagaggtgcccggggacagaacacc
ctgcgccaactcctggctccagtggtaaaagagatcatcgacgacaagtcgctgattatc
aacacaaaccctgtagaggtgtacaaggcttgggtgaaccaactagaaacacagactgga
gaggccagcaagttgccttatgatgtgaccacagaacaagctctaacatacccagaagtg
aaaaataaactggaggcttccattgagaacctgagaagggtcaccgacaaagtcctgaat
tctatcatttcttcccttgatctactgccttatggattgaggtatatagccaaagtactg
aagaattcgatccatgagaaattccccgatgcaacagaagatgagctattaaagattgtt
ggaaacctcctgtactatcggtacatgaatccagccattgtagctccagatggctttgat
atcatcgacatgacagctggaggtcagataaattctgaccaaaggagaaacttaggatca
gtggccaaggttcttcagcacgcagcctccaacaagctgtttgaaggagaaaatgagcat
ctctcatctatgaacaattatttatcagagacgtatcaggaattcaggaaatatttcaaa
gaagcatgtaatgtccctgagccagaagagaagtttaatatggacaaatacacagacctg
gtgacagtcagcaaaccagtcatttatatttcaattgaagaaatcatcagcacacactca
ctcctgttggaacaccaggatgcaattgcccctgagaaaaatgacttactgagtgaattg
ctggggtcgctgggagaggtgccaaccgtggaatcttttcttggggaaggagcagttgac
cccaatgaccctaacaaggcaaatacactaagtcagctttcaaagaccgagatttctctt
gtcttgacaagcaaatatgacatagaggacggtgaagctatagatagccgaagcctcatg
ataaagaccaagaagctgataattgatgtgatccggaaccagccagggaacacattgaca
gaaatcttagagacaccagcaactgcgcaacaggaggtagaccatgccacggacatggtg
agccgtgcaatgatagattccaggactccagaagaaatgaagcatagccaatctatgatt
gaagatgcacagctgcctcttgagcagaagaagaggaaaatccagaggaatcttcggacg
ttggaacagactggacacgtgtcatccgaaaataaataccaagacattctcaatgagatt
gccaaggatattcgaaatcaaagaatctatcgtaagcttcgaaaagctgaattggcaaaa
cttcagcagaccctgaatgcacttaacaagaaggcagcattttatgaagagcaaatcaat
tattatgacacctacataaagacttgtttagacaacttaaaaagaaaaaatactcggaga
tcaattaaactagatggaaaaggagaacccaaaggggcgaagagagcgaagccagtgaag
tacactgcagcaaagctgcatgagaaaggtgtcctgctagatatagatgatcttcaaaca
aaccagtttaagaatgttacatttgatatcatagctactgaagatgtaggcattttcgat
gtaagatcaaaattccttggtgttgagatggaaaaggtgcaactcaatattcaggattta
cttcagatgcaatatgaaggagtagctgtaatgaaaatgtttgataaggttaaagtgaat
gtaaaccttctcatatacctgctgaacaagaagttctatggaaagtga

KEGG   Homo sapiens (human): 128239
Entry
128239            CDS       T01001                                 

Gene name
IQGAP3
Definition
(RefSeq) IQ motif containing GTPase activating protein 3
  KO
K05767  Ras GTPase-activating-like protein IQGAP2/3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    128239 (IQGAP3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    128239 (IQGAP3)
   04147 Exosome [BR:hsa04147]
    128239 (IQGAP3)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     128239 (IQGAP3)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   128239 (IQGAP3)
  Exosomal proteins of colorectal cancer cells
   128239 (IQGAP3)
SSDB
Motif
Pfam: RasGAP RasGAP_C CH IQ SHD1 CAMSAP_CH
Other DBs
NCBI-GeneID: 128239
NCBI-ProteinID: NP_839943
HGNC: 20669
Ensembl: ENSG00000183856
Vega: OTTHUMG00000033114
Pharos: Q86VI3(Tbio)
UniProt: Q86VI3
LinkDB
Structure
PDB: 
3ISU

Position
1q22
AA seq 1631 aa
MERRAAGPGWAAYERLTAEEMDEQRRQNVAYQYLCRLEEAKRWMEACLKEELPSPVELEE
SLRNGVLLAKLGHCFAPSVVPLKKIYDVEQLRYQATGLHFRHTDNINFWLSAIAHIGLPS
TFFPETTDIYDKKNMPRVVYCIHALSLFLFRLGLAPQIHDLYGKVKFTAEELSNMASELA
KYGLQLPAFSKIGGILANELSVDEAAVHAAVLAINEAVERGVVEDTLAALQNPSALLENL
REPLAAVYQEMLAQAKMEKAANARNHDDRESQDIYDHYLTQAEIQGNINHVNVHGALEVV
DDALERQSPEALLKALQDPALALRGVRRDFADWYLEQLNSDREQKAQELGLVELLEKEEV
QAGVAAANTKGDQEQAMLHAVQRINKAIRRRVAADTVKELMCPEAQLPPVYPVASSMYQL
ELAVLQQQQGELGQEELFVAVEMLSAVVLINRALEARDASGFWSSLVNPATGLAEVEGEN
AQRYFDALLKLRQERGMGEDFLSWNDLQATVSQVNAQTQEETDRVLAVSLINEALDKGSP
EKTLSALLLPAAGLDDVSLPVAPRYHLLLVAAKRQKAQVTGDPGAVLWLEEIRQGVVRAN
QDTNTAQRMALGVAAINQAIKEGKAAQTERVLRNPAVALRGVVPDCANGYQRALESAMAK
KQRPADTAFWVQHDMKDGTAYYFHLQTFQGIWEQPPGCPLNTSHLTREEIQSAVTKVTAA
YDRQQLWKANVGFVIQLQARLRGFLVRQKFAEHSHFLRTWLPAVIKIQAHWRGYRQRKIY
LEWLQYFKANLDAIIKIQAWARMWAARRQYLRRLHYFQKNVNSIVKIQAFFRARKAQDDY
RILVHAPHPPLSVVRRFAHLLNQSQQDFLAEAELLKLQEEVVRKIRSNQQLEQDLNIMDI
KIGLLVKNRITLQEVVSHCKKLTKRNKEQLSDMMVLDKQKGLKSLSKEKRQKLEAYQHLF
YLLQTQPIYLAKLIFQMPQNKTTKFMEAVIFSLYNYASSRREAYLLLQLFKTALQEEIKS
KVEQPQDVVTGNPTVVRLVVRFYRNGRGQSALQEILGKVIQDVLEDKVLSVHTDPVHLYK
NWINQTEAQTGQRSHLPYDVTPEQALSHPEVQRRLDIALRNLLAMTDKFLLAITSSVDQI
PYGMRYVAKVLKATLAEKFPDATDSEVYKVVGNLLYYRFLNPAVVAPDAFDIVAMAAGGA
LAAPQRHALGAVAQLLQHAAAGKAFSGQSQHLRVLNDYLEETHLKFRKFIHRACQVPEPE
ERFAVDEYSDMVAVAKPMVYITVGELVNTHRLLLEHQDCIAPDHQDPLHELLEDLGELPT
IPDLIGESIAADGHTDLSKLEVSLTLTNKFEGLEADADDSNTRSLLLSTKQLLADIIQFH
PGDTLKEILSLSASREQEAAHKQLMSRRQACTAQTPEPLRRHRSLTAHSLLPLAEKQRRV
LRNLRRLEALGLVSARNGYQGLVDELAKDIRNQHRHRHRRKAELVKLQATLQGLSTKTTF
YEEQGDYYSQYIRACLDHLAPDSKSSGKGKKQPSLHYTAAQLLEKGVLVEIEDLPASHFR
NVIFDITPGDEAGKFEVNAKFLGVDMERFQLHYQDLLQLQYEGVAVMKLFNKAKVNVNLL
IFLLNKKFLRK
NT seq 4896 nt   +upstreamnt  +downstreamnt
atggagaggagagcagcgggcccaggctgggcagcctatgaacgcctcacagctgaggag
atggatgagcagaggcggcagaatgttgcctatcagtacctgtgccggctggaggaggcc
aagcgctggatggaggcctgcctgaaggaggagcttccttccccggtggagctggaggag
agccttcggaatggagtgctgctggccaagctaggccactgttttgcaccctccgtggtt
cccttgaagaagatctacgatgtggagcagctgcggtaccaggcaactggcttacatttc
cgtcacacagacaacatcaacttttggctatctgcaatagcccacatcggtctgccttcg
accttcttcccagagaccacggacatctatgacaaaaagaacatgccccgggtagtctac
tgcatccatgctctcagtctcttcctcttccggctgggattggcccctcagatacatgat
ctatacgggaaagtgaaattcacagctgaggaactcagcaacatggcgtccgaactggcc
aaatatggcctccagctgcctgccttcagcaagatcgggggcatcttggccaatgagctc
tcggtggatgaggctgcagtccatgcagctgttcttgccatcaatgaagcagtggagcga
ggggtggtggaggacaccctggctgccttgcagaatcccagtgctcttctggagaatctc
cgagagcctctggcagccgtctaccaagagatgctggcccaggccaagatggagaaggca
gccaatgccaggaaccatgatgacagagaaagccaggacatctatgaccactacctaact
caggctgaaatccagggcaatatcaaccatgtcaacgtccatggggctctagaagttgtt
gatgatgccctggaaagacagagccctgaagccttgctcaaggcccttcaagaccctgcc
ctggccctgcgaggggtgaggagagactttgctgactggtacctggagcagctgaactca
gacagagagcagaaggcacaggagctgggcctggtggagcttctggaaaaggaggaagtc
caggctggtgtggctgcagccaacacaaagggtgatcaggaacaagccatgctccacgct
gtgcagcggatcaacaaagccatccggaggagagtggcggctgacactgtgaaggagctg
atgtgccctgaggcccagctgcctccagtgtaccctgttgcatcgtctatgtaccagctg
gagctggcagtgctccagcagcagcagggggagcttggccaggaggagctcttcgtggct
gtggagatgctctcagctgtggtcctgattaaccgggccctggaggcccgggatgccagt
ggcttctggagcagcctggtgaaccctgccacaggcctggctgaggtggaaggagaaaat
gcccagcgttacttcgatgccctgctgaaattgcgacaggagcgtgggatgggtgaggac
ttcctgagctggaatgacctgcaggccaccgtgagccaggtcaatgcacagacccaggaa
gagactgaccgggtccttgcagtcagcctcatcaatgaggctctggacaaaggcagccct
gagaagactctgtctgccctactgcttcctgcagctggcctagatgatgtcagcctccct
gtcgcccctcggtaccatctcctccttgtggcagccaaaaggcagaaggcccaggtgaca
ggggatcctggagctgtgctgtggcttgaggagatccgccagggagtggtcagagccaac
caggacactaatacagctcagagaatggctcttggtgtggctgccatcaatcaagccatc
aaggagggcaaggcagcccagactgagcgggtgttgaggaaccccgcagtggcccttcga
ggggtagttcccgactgtgccaacggctaccagcgagccctggaaagtgccatggcaaag
aaacagcgtccagcagacacagctttctgggttcaacatgacatgaaggatggcactgcc
tactacttccatctgcagaccttccaggggatctgggagcaacctcctggctgccccctc
aacacctctcacctgacccgggaggagatccagtcagctgtcaccaaggtcactgctgcc
tatgaccgccaacagctctggaaagccaacgtcggctttgttatccagctccaggcccgc
ctccgtggcttcctagttcggcagaagtttgctgagcattcccactttctgaggacctgg
ctcccagcagtcatcaagatccaggctcattggcggggttataggcagcggaagatttac
ctggagtggttgcagtattttaaagcaaacctggatgccataatcaagatccaggcctgg
gcccggatgtgggcagctcggaggcaatacctgaggcgtctgcactacttccagaagaat
gttaactccattgtgaagatccaggcatttttccgagccaggaaagcccaagatgactac
aggatattagtgcatgcaccccaccctcctctcagtgtggtacgcagatttgcccatctc
ttgaatcaaagccagcaagacttcttggctgaggcagagctgctgaagctccaggaagag
gtagttaggaagatccgatccaatcagcagctggagcaggacctcaacatcatggacatc
aagattggcctgctggtgaagaaccggatcactctgcaggaagtggtctcccactgcaag
aagctgaccaagaggaataaggaacagctgtcagatatgatggttctggacaagcagaag
ggtttaaagtcgctgagcaaagagaaacggcagaaactagaagcataccaacacctcttc
tacctgctccagactcagcccatctacctggccaagctgatctttcagatgccacagaac
aaaaccaccaagttcatggaggcagtgattttcagcctgtacaactatgcctccagccgc
cgagaggcctatctcctgctccagctgttcaagacagcactccaggaggaaatcaagtca
aaggtggagcagccccaggacgtggtgacaggcaacccaacagtggtgaggctggtggtg
agattctaccgtaatgggcggggacagagtgccctgcaggagattctgggcaaggttatc
caggatgtgctagaagacaaagtgctcagcgtccacacagaccctgtccacctctataag
aactggatcaaccagactgaggcccagacagggcagcgcagccatctcccatatgatgtc
accccggagcaggccttgagccaccccgaggtccagagacgactggacatcgccctacgc
aacctcctcgccatgactgataagttccttttagccatcacctcatctgtggaccaaatt
ccgtatgggatgcgatatgtggccaaagtcctgaaggcaactctggcagagaaattccct
gacgccacagacagcgaggtctataaggtggtcgggaacctcctgtactaccgcttcctg
aacccagctgtggtggctcctgacgccttcgacattgtggccatggcagctggtggagcc
ctggctgccccccagcgccatgccctgggggctgtggctcagctcctacagcacgctgcg
gctggcaaggccttctctgggcagagccagcacctacgggtcctgaatgactatctggag
gaaacacacctcaagttcaggaagttcatccatagagcctgccaggtgccagagccagag
gagcgttttgcagtggacgagtactcagacatggtggctgtggccaaacccatggtgtac
atcaccgtgggggagctggtcaacacgcacaggctgttgctggagcaccaggactgcatt
gcccctgatcaccaagaccccctgcatgagctcctggaggatcttggggagctgcccacc
atccctgaccttattggtgagagcatcgctgcagatgggcacacggacctgagcaagcta
gaagtgtccctgacgctgaccaacaagtttgaaggactagaggcagatgctgatgactcc
aacacccgtagcctgcttctgagcaccaagcagctgttggccgatatcatacagttccat
cctggggacaccctcaaggagatcctgtccctctcggcttccagagagcaagaagcagcc
cacaagcagctgatgagccgacgccaggcctgtacagcccagacaccggagccactgcga
cgacaccgctcactgacagctcactccctcctgccactggcagagaagcagcggcgcgtc
ctgcggaacctacgccgacttgaagccctggggttggtcagcgccagaaatggctaccag
gggctagtggacgagctggccaaggacatccgcaaccagcacagacacaggcacaggcgg
aaggcagagctggtgaagctgcaggccacattacagggcctgagcactaagaccaccttc
tatgaggagcagggtgactactacagccagtacatccgggcctgcctggaccacctggcc
cccgactccaagagttctgggaaggggaagaagcagccttctcttcattacactgctgct
cagctcctggaaaagggtgtcttggtggaaattgaagatcttcccgcctctcacttcaga
aacgtcatctttgacatcacgccgggagatgaggcaggaaagtttgaagtaaatgccaag
ttcctgggtgtggacatggagcgatttcagcttcactatcaggatctcctgcagctccag
tatgagggtgtggctgtcatgaaactcttcaacaaggccaaagtcaatgtcaaccttctc
atcttcctcctcaacaagaagtttttgcggaagtga

KEGG   Homo sapiens (human): 8826
Entry
8826              CDS       T01001                                 

Gene name
IQGAP1, HUMORFA01, SAR1, p195
Definition
(RefSeq) IQ motif containing GTPase activating protein 1
  KO
K16848  Ras GTPase-activating-like protein IQGAP1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04520  Adherens junction
hsa04810  Regulation of actin cytoskeleton
hsa05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    8826 (IQGAP1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    8826 (IQGAP1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    8826 (IQGAP1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    8826 (IQGAP1)
   04147 Exosome [BR:hsa04147]
    8826 (IQGAP1)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     8826 (IQGAP1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   8826 (IQGAP1)
  Exosomal proteins of breast milk
   8826 (IQGAP1)
  Exosomal proteins of other body fluids (saliva and urine)
   8826 (IQGAP1)
  Exosomal proteins of colorectal cancer cells
   8826 (IQGAP1)
SSDB
Motif
Pfam: RasGAP RasGAP_C CH IQ WW bZIP_1 CAMSAP_CH DUF5390
Other DBs
NCBI-GeneID: 8826
NCBI-ProteinID: NP_003861
OMIM: 603379
HGNC: 6110
Ensembl: ENSG00000140575
Vega: OTTHUMG00000149832
Pharos: P46940(Tbio)
UniProt: P46940 A0A024RC65
LinkDB
Structure
PDB: 
3FAY 5L0O 3I6X 2RR8 1X0H

Position
15q26.1
AA seq 1657 aa
MSAADEVDGLGVARPHYGSVLDNERLTAEEMDERRRQNVAYEYLCHLEEAKRWMEACLGE
DLPPTTELEEGLRNGVYLAKLGNFFSPKVVSLKKIYDREQTRYKATGLHFRHTDNVIQWL
NAMDEIGLPKIFYPETTDIYDRKNMPRCIYCIHALSLYLFKLGLAPQIQDLYGKVDFTEE
EINNMKTELEKYGIQMPAFSKIGGILANELSVDEAALHAAVIAINEAIDRRIPADTFAAL
KNPNAMLVNLEEPLASTYQDILYQAKQDKMTNAKNRTENSERERDVYEELLTQAEIQGNI
NKVNTFSALANIDLALEQGDALALFRALQSPALGLRGLQQQNSDWYLKQLLSDKQQKRQS
GQTDPLQKEELQSGVDAANSAAQQYQRRLAAVALINAAIQKGVAEKTVLELMNPEAQLPQ
VYPFAADLYQKELATLQRQSPEHNLTHPELSVAVEMLSSVALINRALESGDVNTVWKQLS
SSVTGLTNIEEENCQRYLDELMKLKAQAHAENNEFITWNDIQACVDHVNLVVQEEHERIL
AIGLINEALDEGDAQKTLQALQIPAAKLEGVLAEVAQHYQDTLIRAKREKAQEIQDESAV
LWLDEIQGGIWQSNKDTQEAQKFALGIFAINEAVESGDVGKTLSALRSPDVGLYGVIPEC
GETYHSDLAEAKKKKLAVGDNNSKWVKHWVKGGYYYYHNLETQEGGWDEPPNFVQNSMQL
SREEIQSSISGVTAAYNREQLWLANEGLITRLQARCRGYLVRQEFRSRMNFLKKQIPAIT
CIQSQWRGYKQKKAYQDRLAYLRSHKDEVVKIQSLARMHQARKRYRDRLQYFRDHINDII
KIQAFIRANKARDDYKTLINAEDPPMVVVRKFVHLLDQSDQDFQEELDLMKMREEVITLI
RSNQQLENDLNLMDIKIGLLVKNKITLQDVVSHSKKLTKKNKEQLSDMMMINKQKGGLKA
LSKEKREKLEAYQHLFYLLQTNPTYLAKLIFQMPQNKSTKFMDSVIFTLYNYASNQREEY
LLLRLFKTALQEEIKSKVDQIQEIVTGNPTVIKMVVSFNRGARGQNALRQILAPVVKEIM
DDKSLNIKTDPVDIYKSWVNQMESQTGEASKLPYDVTPEQALAHEEVKTRLDSSIRNMRA
VTDKFLSAIVSSVDKIPYGMRFIAKVLKDSLHEKFPDAGEDELLKIIGNLLYYRYMNPAI
VAPDAFDIIDLSAGGQLTTDQRRNLGSIAKMLQHAASNKMFLGDNAHLSIINEYLSQSYQ
KFRRFFQTACDVPELQDKFNVDEYSDLVTLTKPVIYISIGEIINTHTLLLDHQDAIAPEH
NDPIHELLDDLGEVPTIESLIGESSGNLNDPNKEALAKTEVSLTLTNKFDVPGDENAEMD
ARTILLNTKRLIVDVIRFQPGETLTEILETPATSEQEAEHQRAMQRRAIRDAKTPDKMKK
SKSVKEDSNLTLQEKKEKIQTGLKKLTELGTVDPKNKYQELINDIARDIRNQRRYRQRRK
AELVKLQQTYAALNSKATFYGEQVDYYKSYIKTCLDNLASKGKVSKKPREMKGKKSKKIS
LKYTAARLHEKGVLLEIEDLQVNQFKNVIFEISPTEEVGDFEVKAKFMGVQMETFMLHYQ
DLLQLQYEGVAVMKLFDRAKVNVNLLIFLLNKKFYGK
NT seq 4974 nt   +upstreamnt  +downstreamnt
atgtccgccgcagacgaggttgacgggctgggcgtggcccggccgcactatggctctgtc
ctggataatgaaagacttactgcagaggagatggatgaaaggagacgtcagaacgtggct
tatgagtacctttgtcatttggaagaagcgaagaggtggatggaagcatgcctaggggaa
gatctgcctcccaccacagaactggaggaggggcttaggaatggggtctaccttgccaaa
ctggggaacttcttctctcccaaagtagtgtccctgaaaaaaatctatgatcgagaacag
accagatacaaggcgactggcctccactttagacacactgataatgtgattcagtggttg
aatgccatggatgagattggattgcctaagattttttacccagaaactacagatatctat
gatcgaaagaacatgccaagatgtatctactgtatccatgcactcagtttgtacctgttc
aagctaggcctggcccctcagattcaagacctatatggaaaggttgacttcacagaagaa
gaaatcaacaacatgaagactgagttggagaagtatggcatccagatgcctgcctttagc
aagattgggggcatcttggctaatgaactgtcagtggatgaagccgcattacatgctgct
gttattgctattaatgaagctattgaccgtagaattccagccgacacatttgcagctttg
aaaaatccgaatgccatgcttgtaaatcttgaagagcccttggcatccacttaccaggat
atactttaccaggctaagcaggacaaaatgacaaatgctaaaaacaggacagaaaactca
gagagagaaagagatgtttatgaggagctgctcacgcaagctgaaattcaaggcaatata
aacaaagtcaatacattttctgcattagcaaatatcgacctggctttagaacaaggagat
gcactggccttgttcagggctctgcagtcaccagccctggggcttcgaggactgcagcaa
cagaatagcgactggtacttgaagcagctcctgagtgataaacagcagaagagacagagt
ggtcagactgaccccctgcagaaggaggagctgcagtctggagtggatgctgcaaacagt
gctgcccagcaatatcagagaagattggcagcagtagcactgattaatgctgcaatccag
aagggtgttgctgagaagactgttttggaactgatgaatcccgaagcccagctgccccag
gtgtatccatttgccgccgatctctatcagaaggagctggctaccctgcagcgacaaagt
cctgaacataatctcacccacccagagctctctgtcgcagtggagatgttgtcatcggtg
gccctgatcaacagggcattggaatcaggagatgtgaatacagtgtggaagcaattgagc
agttcagttactggtcttaccaatattgaggaagaaaactgtcagaggtatctcgatgag
ttgatgaaactgaaggctcaggcacatgcagagaataatgaattcattacatggaatgat
atccaagcttgcgtggaccatgtgaacctggtggtgcaagaggaacatgagaggatttta
gccattggtttaattaatgaagccctggatgaaggtgatgcccaaaagactctgcaggcc
ctacagattcctgcagctaaacttgagggagtccttgcagaagtggcccagcattaccaa
gacacgctgattagagcgaagagagagaaagcccaggaaatccaggatgagtcagctgtg
ttatggttggatgaaattcaaggtggaatctggcagtccaacaaagacacccaagaagca
cagaagtttgccttaggaatctttgccattaatgaggcagtagaaagtggtgatgttggc
aaaacactgagtgcccttcgctcccctgatgttggcttgtatggagtcatccctgagtgt
ggtgaaacttaccacagtgatcttgctgaagccaagaagaaaaaactggcagtaggagat
aataacagcaagtgggtgaagcactgggtaaaaggtggatattattattaccacaatctg
gagacccaggaaggaggatgggatgaacctccaaattttgtgcaaaattctatgcagctt
tctcgggaggagatccagagttctatctctggggtgactgccgcatataaccgagaacag
ctgtggctggccaatgaaggcctgatcaccaggctgcaggctcgctgccgtggatactta
gttcgacaggaattccgatccaggatgaatttcctgaagaaacaaatccctgccatcacc
tgcattcagtcacagtggagaggatacaagcagaagaaggcatatcaagatcggttagct
tacctgcgctcccacaaagatgaagttgtaaagattcagtccctggcaaggatgcaccaa
gctcgaaagcgctatcgagatcgcctgcagtacttccgggaccatataaatgacattatc
aaaatccaggcttttattcgggcaaacaaagctcgggatgactacaagactctcatcaat
gctgaggatcctcctatggttgtggtccgaaaatttgtccacctgctggaccaaagtgac
caggattttcaggaggagcttgaccttatgaagatgcgggaagaggttatcaccctcatt
cgttctaaccagcagctggagaatgacctcaatctcatggatatcaaaattggactgcta
gtgaaaaataagattacgttgcaggatgtggtttcccacagtaaaaaacttaccaaaaaa
aataaggaacagttgtctgatatgatgatgataaataaacagaagggaggtctcaaggct
ttgagcaaggagaagagagagaagttggaagcttaccagcacctgttttatttattgcaa
accaatcccacctatctggccaagctcatttttcagatgccccagaacaagtccaccaag
ttcatggactctgtaatcttcacactctacaactacgcgtccaaccagcgagaggagtac
ctgctcctgcggctctttaagacagcactccaagaggaaatcaagtcgaaggtagatcag
attcaagagattgtgacaggaaatcctacggttattaaaatggttgtaagtttcaaccgt
ggtgcccgtggccagaatgccctgagacagatcttggccccagtcgtgaaggaaattatg
gatgacaaatctctcaacatcaaaactgaccctgtggatatttacaaatcttgggttaat
cagatggagtctcagacaggagaggcaagcaaactgccctatgatgtgacccctgagcag
gcgctagctcatgaagaagtgaagacacggctagacagctccatcaggaacatgcgggct
gtgacagacaagtttctctcagccattgtcagctctgtggacaaaatcccttatgggatg
cgcttcattgccaaagtgctgaaggactcgttgcatgagaagttccctgatgctggtgag
gatgagctgctgaagattattggtaacttgctttattatcgatacatgaatccagccatt
gttgctcctgatgcctttgacatcattgacctgtcagcaggaggccagcttaccacagac
caacgccgaaatctgggctccattgcaaaaatgcttcagcatgctgcttccaataagatg
tttctgggagataatgcccacttaagcatcattaatgaatatctttcccagtcctaccag
aaattcagacggtttttccaaactgcttgtgatgtcccagagcttcaggataaatttaat
gtggatgagtactctgatttagtaaccctcaccaaaccagtaatctacatttccattggt
gaaatcatcaacacccacactctcctgttggatcaccaggatgccattgctccggagcac
aatgatccaatccacgaactgctggacgacctcggcgaggtgcccaccatcgagtccctg
ataggggaaagctctggcaatttaaatgacccaaataaggaggcactggctaagacggaa
gtgtctctcaccctgaccaacaagttcgacgtgcctggagatgagaatgcagaaatggat
gctcgaaccatcttactgaatacaaaacgtttaattgtggatgtcatccggttccagcca
ggagagaccttgactgaaatcctagaaacaccagccaccagtgaacaggaagcagaacat
cagagagccatgcagagacgtgctatccgtgatgccaaaacacctgacaagatgaaaaag
tcaaaatctgtaaaggaagacagcaacctcactcttcaagagaagaaagagaagatccag
acaggtttaaagaagctaacagagcttggaaccgtggacccaaagaacaaataccaggaa
ctgatcaacgacattgccagggatattcggaatcagcggaggtaccgacagaggagaaag
gccgaactagtgaaactgcaacagacatacgctgctctgaactctaaggccaccttttat
ggggagcaggtggattactataaaagctatatcaaaacctgcttggataacttagccagc
aagggcaaagtctccaaaaagcctagggaaatgaaaggaaagaaaagcaaaaagatttct
ctgaaatatacagcagcaagactacatgaaaaaggagttcttctggaaattgaggacctg
caagtgaatcagtttaaaaatgttatatttgaaatcagtccaacagaagaagttggagac
ttcgaagtgaaagccaaattcatgggagttcaaatggagacttttatgttacattatcag
gacctgctgcagctacagtatgaaggagttgcagtcatgaaattatttgatagagctaaa
gtaaatgtcaacctcctgatcttccttctcaacaaaaagttctacgggaagtaa

DBGET integrated database retrieval system