KEGG   Homo sapiens (human): 10850
Entry
10850             CDS       T01001                                 
Symbol
CCL27, ALP, CTACK, CTAK, ESKINE, ILC, PESKY, SCYA27
Name
(RefSeq) C-C motif chemokine ligand 27
  KO
K16598  C-C motif chemokine 27
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
Network
nt06150  Cytokine-cytokine receptor interaction (viruses)
  Element
N01173  CCL2/7/8/13/27 to CCR2 signaling
N01181  CCL5/7/11/13/15/24/26/27/28 to CCR3 signaling
N01225  CCL27/28 to CCR10 signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    10850 (CCL27)
   04061 Viral protein interaction with cytokine and cytokine receptor
    10850 (CCL27)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    10850 (CCL27)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    10850 (CCL27)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   10850 (CCL27)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 10850
NCBI-ProteinID: NP_006655
OMIM: 604833
HGNC: 10626
Ensembl: ENSG00000213927
Pharos: Q9Y4X3(Tbio)
UniProt: Q9Y4X3 Q5VZ77
Structure
LinkDB
Position
9:complement(34661890..34662657)
AA seq 112 aa
MKGPPTFCSLLLLSLLLSPDPTAAFLLPPSTACCTQLYRKPLSDKLLRKVIQVELQEADG
DCHLQAFVLHLAQRSICIHPQNPSLSQWFEHQERKLHGTLPKLNFGMLRKMG
NT seq 339 nt   +upstreamnt  +downstreamnt
atgaaggggcccccaaccttctgcagcctcctgctgctgtcattgctcctgagcccagac
cctacagcagcattcctactgccacccagcactgcctgctgtactcagctctaccgaaag
ccactctcagacaagctactgaggaaggtcatccaggtggaactgcaggaggctgacggg
gactgtcacctccaggctttcgtgcttcacctggctcaacgcagcatctgcatccacccc
cagaaccccagcctgtcacagtggtttgagcaccaagagagaaagctccatgggactctg
cccaagctgaattttgggatgctaaggaaaatgggctga

KEGG   Homo sapiens (human): 56477
Entry
56477             CDS       T01001                                 
Symbol
CCL28, CCK1, MEC, SCYA28
Name
(RefSeq) C-C motif chemokine ligand 28
  KO
K05513  C-C motif chemokine 28
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
hsa04672  Intestinal immune network for IgA production
Network
nt06150  Cytokine-cytokine receptor interaction (viruses)
  Element
N01181  CCL5/7/11/13/15/24/26/27/28 to CCR3 signaling
N01183  CCL5/11/13/26/28 to HCMV US28 signaling
N01186  HSV1 SgG1 to CCR signaling
N01187  HSV2 SgG2 to CCR signaling
N01188  VAV CrmB to CCR signaling
N01225  CCL27/28 to CCR10 signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    56477 (CCL28)
   04061 Viral protein interaction with cytokine and cytokine receptor
    56477 (CCL28)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    56477 (CCL28)
   04062 Chemokine signaling pathway
    56477 (CCL28)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    56477 (CCL28)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   56477 (CCL28)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 56477
NCBI-ProteinID: NP_001288802
OMIM: 605240
HGNC: 17700
Ensembl: ENSG00000151882
Pharos: Q9NRJ3(Tbio)
UniProt: Q9NRJ3 A0N0Q3
Structure
LinkDB
Position
5:complement(43356975..43412391)
AA seq 127 aa
MQQRGLAIVALAVCAALHASEAILPIASSCCTEVSHHISRRLLERVNMCRIQRADGDCDL
AAVILHVKRRRICVSPHNHTVKQWMKVQAAKKNGKGNVCHRKKHHGKRNSNRAHQGKHET
YGHKTPY
NT seq 384 nt   +upstreamnt  +downstreamnt
atgcagcagagaggactcgccatcgtggccttggctgtctgtgcggccctacatgcctca
gaagccatacttcccattgcctccagctgttgcacggaggtttcacatcatatttccaga
aggctcctggaaagagtgaatatgtgtcgcatccagagagctgatggggattgtgacttg
gctgctgtcatccttcatgtcaagcgcagaagaatctgtgtcagcccgcacaaccatact
gttaagcagtggatgaaagtgcaagctgccaagaaaaatggtaaaggaaatgtttgccac
aggaagaaacaccatggcaagaggaacagtaacagggcacatcaggggaaacacgaaaca
tacggccataaaactccttattag

DBGET integrated database retrieval system