KEGG   Homo sapiens (human): 10850
Entry
10850             CDS       T01001                                 
Symbol
CCL27, ALP, CTACK, CTAK, ESKINE, ILC, PESKY, SCYA27
Name
(RefSeq) C-C motif chemokine ligand 27
  KO
K16598  C-C motif chemokine 27
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
Network
nt06150  Cytokine-cytokine receptor interaction (viruses)
  Element
N01173  CCL2/7/8/13/27 to CCR2 signaling
N01181  CCL5/7/11/13/15/24/26/27/28 to CCR3 signaling
N01225  CCL27/28 to CCR10 signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    10850 (CCL27)
   04061 Viral protein interaction with cytokine and cytokine receptor
    10850 (CCL27)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    10850 (CCL27)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    10850 (CCL27)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   10850 (CCL27)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 10850
NCBI-ProteinID: NP_006655
OMIM: 604833
HGNC: 10626
Ensembl: ENSG00000213927
Pharos: Q9Y4X3(Tbio)
UniProt: Q9Y4X3 Q5VZ77
Structure
LinkDB
Position
9:complement(34661890..34662657)
AA seq 112 aa
MKGPPTFCSLLLLSLLLSPDPTAAFLLPPSTACCTQLYRKPLSDKLLRKVIQVELQEADG
DCHLQAFVLHLAQRSICIHPQNPSLSQWFEHQERKLHGTLPKLNFGMLRKMG
NT seq 339 nt   +upstreamnt  +downstreamnt
atgaaggggcccccaaccttctgcagcctcctgctgctgtcattgctcctgagcccagac
cctacagcagcattcctactgccacccagcactgcctgctgtactcagctctaccgaaag
ccactctcagacaagctactgaggaaggtcatccaggtggaactgcaggaggctgacggg
gactgtcacctccaggctttcgtgcttcacctggctcaacgcagcatctgcatccacccc
cagaaccccagcctgtcacagtggtttgagcaccaagagagaaagctccatgggactctg
cccaagctgaattttgggatgctaaggaaaatgggctga

KEGG   Homo sapiens (human): 6347
Entry
6347              CDS       T01001                                 
Symbol
CCL2, GDCF-2, HC11, HSMCR30, MCAF, MCP-1, MCP1, SCYA2, SMC-CF
Name
(RefSeq) C-C motif chemokine ligand 2
  KO
K14624  C-C motif chemokine 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04657  IL-17 signaling pathway
hsa04668  TNF signaling pathway
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa05135  Yersinia infection
hsa05142  Chagas disease
hsa05144  Malaria
hsa05163  Human cytomegalovirus infection
hsa05164  Influenza A
hsa05168  Herpes simplex virus 1 infection
hsa05171  Coronavirus disease - COVID-19
hsa05323  Rheumatoid arthritis
hsa05417  Lipid and atherosclerosis
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06123  TNF signaling (viruses and bacteria)
nt06124  Chemokine signaling (viruses)
nt06150  Cytokine-cytokine receptor interaction (viruses)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06171  Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
nt06224  CXCR signaling
  Element
N00153  CCR/CXCR-GNB/G-PI3K-RAC signaling pathway
N00399  CCR2-GNB/G-PI3K-NFKB signaling pathway
N00406  HCMV US28 to GNA12/13-Rho signaling pathway
N00560  HSV gD to HVEM-NFKB signaling pathway
N01173  CCL2/7/8/13/27 to CCR2 signaling
N01174  VAV vCCI to CCR signaling
N01175  CCL2 to HCMV US28 signaling
N01176  CCL2 to HHV6 U12 signaling
N01177  CCL2 to HHV6 U51 signaling
N01307  SARS-CoV-2 S to AngII-AT1R-NOX2 signaling pathway
Disease
H00342  Tuberculosis
H01563  HIV infection
H02563  Neural tube defects
Drug target
Bindarit: D03116
Carlumab: D09877
Pirfenidone: D01583<JP/US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    6347 (CCL2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6347 (CCL2)
   04061 Viral protein interaction with cytokine and cytokine receptor
    6347 (CCL2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    6347 (CCL2)
   04657 IL-17 signaling pathway
    6347 (CCL2)
   04062 Chemokine signaling pathway
    6347 (CCL2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    6347 (CCL2)
   05164 Influenza A
    6347 (CCL2)
   05168 Herpes simplex virus 1 infection
    6347 (CCL2)
   05163 Human cytomegalovirus infection
    6347 (CCL2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    6347 (CCL2)
  09174 Infectious disease: parasitic
   05144 Malaria
    6347 (CCL2)
   05142 Chagas disease
    6347 (CCL2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    6347 (CCL2)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    6347 (CCL2)
   05418 Fluid shear stress and atherosclerosis
    6347 (CCL2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    6347 (CCL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    6347 (CCL2)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    6347 (CCL2)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   6347 (CCL2)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Heparin
  Chemokines
   6347 (CCL2)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 6347
NCBI-ProteinID: NP_002973
OMIM: 158105
HGNC: 10618
Ensembl: ENSG00000108691
Pharos: P13500(Tchem)
UniProt: P13500
Structure
LinkDB
Position
17:34255285..34257203
AA seq 99 aa
MKVSAALLCLLLIAATFIPQGLAQPDAINAPVTCCYNFTNRKISVQRLASYRRITSSKCP
KEAVIFKTIVAKEICADPKQKWVQDSMDHLDKQTQTPKT
NT seq 300 nt   +upstreamnt  +downstreamnt
atgaaagtctctgccgcccttctgtgcctgctgctcatagcagccaccttcattccccaa
gggctcgctcagccagatgcaatcaatgccccagtcacctgctgttataacttcaccaat
aggaagatctcagtgcagaggctcgcgagctatagaagaatcaccagcagcaagtgtccc
aaagaagctgtgatcttcaagaccattgtggccaaggagatctgtgctgaccccaagcag
aagtgggttcaggattccatggaccacctggacaagcaaacccaaactccgaagacttga

KEGG   Homo sapiens (human): 6354
Entry
6354              CDS       T01001                                 
Symbol
CCL7, FIC, MARC, MCP-3, MCP3, NC28, SCYA6, SCYA7
Name
(RefSeq) C-C motif chemokine ligand 7
  KO
K05509  C-C motif chemokine 7
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
hsa04657  IL-17 signaling pathway
Network
nt06150  Cytokine-cytokine receptor interaction (viruses)
  Element
N01166  CCL3/5/7/8/13/14/15/16/23 to CCR1 signaling
N01167  VAV vCCI to CCR signaling
N01168  CCL3/7 to HCMV US28 signaling
N01173  CCL2/7/8/13/27 to CCR2 signaling
N01181  CCL5/7/11/13/15/24/26/27/28 to CCR3 signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6354 (CCL7)
   04061 Viral protein interaction with cytokine and cytokine receptor
    6354 (CCL7)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    6354 (CCL7)
   04062 Chemokine signaling pathway
    6354 (CCL7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    6354 (CCL7)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   6354 (CCL7)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 6354
NCBI-ProteinID: NP_006264
OMIM: 158106
HGNC: 10634
Ensembl: ENSG00000108688
Pharos: P80098(Tbio)
UniProt: P80098
Structure
LinkDB
Position
17:34270221..34272242
AA seq 99 aa
MKASAALLCLLLTAAAFSPQGLAQPVGINTSTTCCYRFINKKIPKQRLESYRRTTSSHCP
REAVIFKTKLDKEICADPTQKWVQDFMKHLDKKTQTPKL
NT seq 300 nt   +upstreamnt  +downstreamnt
atgaaagcctctgcagcacttctgtgtctgctgctcacagcagctgctttcagcccccag
gggcttgctcagccagttgggattaatacttcaactacctgctgctacagatttatcaat
aagaaaatccctaagcagaggctggagagctacagaaggaccaccagtagccactgtccc
cgggaagctgtaatcttcaagaccaaactggacaaggagatctgtgctgaccccacacag
aagtgggtccaggactttatgaagcacctggacaagaaaacccaaactccaaagctttga

KEGG   Homo sapiens (human): 6355
Entry
6355              CDS       T01001                                 
Symbol
CCL8, HC14, MCP-2, MCP2, SCYA10, SCYA8
Name
(RefSeq) C-C motif chemokine ligand 8
  KO
K16596  C-C motif chemokine 8
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
Network
nt06150  Cytokine-cytokine receptor interaction (viruses)
  Element
N01166  CCL3/5/7/8/13/14/15/16/23 to CCR1 signaling
N01173  CCL2/7/8/13/27 to CCR2 signaling
N01196  CCL3/4/5/8 to CCR5 signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6355 (CCL8)
   04061 Viral protein interaction with cytokine and cytokine receptor
    6355 (CCL8)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    6355 (CCL8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    6355 (CCL8)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   6355 (CCL8)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 6355
NCBI-ProteinID: NP_005614
OMIM: 602283
HGNC: 10635
Ensembl: ENSG00000108700
Pharos: P80075(Tbio)
UniProt: P80075
Structure
LinkDB
Position
17:34319435..34321402
AA seq 99 aa
MKVSAALLCLLLMAATFSPQGLAQPDSVSIPITCCFNVINRKIPIQRLESYTRITNIQCP
KEAVIFKTKRGKEVCADPKERWVRDSMKHLDQIFQNLKP
NT seq 300 nt   +upstreamnt  +downstreamnt
atgaaggtttctgcagcgcttctgtgcctgctgctcatggcagccactttcagccctcag
ggacttgctcagccagattcagtttccattccaatcacctgctgctttaacgtgatcaat
aggaaaattcctatccagaggctggagagctacacaagaatcaccaacatccaatgtccc
aaggaagctgtgatcttcaagaccaaacggggcaaggaggtctgtgctgaccccaaggag
agatgggtcagggattccatgaagcatctggaccaaatatttcaaaatctgaagccatga

KEGG   Homo sapiens (human): 6357
Entry
6357              CDS       T01001                                 
Symbol
CCL13, CKb10, MCP-4, NCC-1, NCC1, SCYA13, SCYL1
Name
(RefSeq) C-C motif chemokine ligand 13
  KO
K16595  C-C motif chemokine 13
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
hsa04064  NF-kappa B signaling pathway
Network
nt06150  Cytokine-cytokine receptor interaction (viruses)
  Element
N01166  CCL3/5/7/8/13/14/15/16/23 to CCR1 signaling
N01173  CCL2/7/8/13/27 to CCR2 signaling
N01181  CCL5/7/11/13/15/24/26/27/28 to CCR3 signaling
N01182  VAV vCCI to CCR signaling
N01183  CCL5/11/13/26/28 to HCMV US28 signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    6357 (CCL13)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6357 (CCL13)
   04061 Viral protein interaction with cytokine and cytokine receptor
    6357 (CCL13)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    6357 (CCL13)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    6357 (CCL13)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    6357 (CCL13)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   6357 (CCL13)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Heparin
  Chemokines
   6357 (CCL13)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 6357
NCBI-ProteinID: NP_005399
OMIM: 601391
HGNC: 10611
Ensembl: ENSG00000181374
Pharos: Q99616(Tbio)
UniProt: Q99616
Structure
LinkDB
Position
17:34356480..34358610
AA seq 98 aa
MKVSAVLLCLLLMTAAFNPQGLAQPDALNVPSTCCFTFSSKKISLQRLKSYVITTSRCPQ
KAVIFRTKLGKEICADPKEKWVQNYMKHLGRKAHTLKT
NT seq 297 nt   +upstreamnt  +downstreamnt
atgaaagtctctgcagtgcttctgtgcctgctgctcatgacagcagctttcaacccccag
ggacttgctcagccagatgcactcaacgtcccatctacttgctgcttcacatttagcagt
aagaagatctccttgcagaggctgaagagctatgtgatcaccaccagcaggtgtccccag
aaggctgtcatcttcagaaccaaactgggcaaggagatctgtgctgacccaaaggagaag
tgggtccagaattatatgaaacacctgggccggaaagctcacaccctgaagacttga

DBGET integrated database retrieval system