KEGG   Homo sapiens (human): 10855
Entry
10855             CDS       T01001                                 
Symbol
HPSE, HPA, HPA1, HPR1, HPSE1, HSE1
Name
(RefSeq) heparanase
  KO
K07964  heparanase [EC:3.2.1.166]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00531  Glycosaminoglycan degradation
hsa01100  Metabolic pathways
hsa05205  Proteoglycans in cancer
Module
hsa_M00078  Heparan sulfate degradation
Drug target
Necuparanib (DG03098): D11764 D11765
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    10855 (HPSE)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    10855 (HPSE)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    10855 (HPSE)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.166  heparanase
     10855 (HPSE)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Heparin
  Enzymes
   10855 (HPSE)
SSDB
Motif
Pfam: Glyco_hydro_79n
Other DBs
NCBI-GeneID: 10855
NCBI-ProteinID: NP_001092010
OMIM: 604724
HGNC: 5164
Ensembl: ENSG00000173083
Vega: OTTHUMG00000130425
Pharos: Q9Y251(Tchem)
UniProt: Q9Y251
Structure
LinkDB
Position
4:complement(83292461..83335153)
AA seq 543 aa
MLLRSKPALPPPLMLLLLGPLGPLSPGALPRPAQAQDVVDLDFFTQEPLHLVSPSFLSVT
IDANLATDPRFLILLGSPKLRTLARGLSPAYLRFGGTKTDFLIFDPKKESTFEERSYWQS
QVNQDICKYGSIPPDVEEKLRLEWPYQEQLLLREHYQKKFKNSTYSRSSVDVLYTFANCS
GLDLIFGLNALLRTADLQWNSSNAQLLLDYCSSKGYNISWELGNEPNSFLKKADIFINGS
QLGEDFIQLHKLLRKSTFKNAKLYGPDVGQPRRKTAKMLKSFLKAGGEVIDSVTWHHYYL
NGRTATKEDFLNPDVLDIFISSVQKVFQVVESTRPGKKVWLGETSSAYGGGAPLLSDTFA
AGFMWLDKLGLSARMGIEVVMRQVFFGAGNYHLVDENFDPLPDYWLSLLFKKLVGTKVLM
ASVQGSKRRKLRVYLHCTNTDNPRYKEGDLTLYAINLHNVTKYLRLPYPFSNKQVDKYLL
RPLGPHGLLSKSVQLNGLTLKMVDDQTLPPLMEKPLRPGSSLGLPAFSYSFFVIRNAKVA
ACI
NT seq 1632 nt   +upstreamnt  +downstreamnt
atgctgctgcgctcgaagcctgcgctgccgccgccgctgatgctgctgctcctggggccg
ctgggtcccctctcccctggcgccctgccccgacctgcgcaagcacaggacgtcgtggac
ctggacttcttcacccaggagccgctgcacctggtgagcccctcgttcctgtccgtcacc
attgacgccaacctggccacggacccgcggttcctcatcctcctgggttctccaaagctt
cgtaccttggccagaggcttgtctcctgcgtacctgaggtttggtggcaccaagacagac
ttcctaattttcgatcccaagaaggaatcaacctttgaagagagaagttactggcaatct
caagtcaaccaggatatttgcaaatatggatccatccctcctgatgtggaggagaagtta
cggttggaatggccctaccaggagcaattgctactccgagaacactaccagaaaaagttc
aagaacagcacctactcaagaagctctgtagatgtgctatacacttttgcaaactgctca
ggactggacttgatctttggcctaaatgcgttattaagaacagcagatttgcagtggaac
agttctaatgctcagttgctcctggactactgctcttccaaggggtataacatttcttgg
gaactaggcaatgaacctaacagtttccttaagaaggctgatattttcatcaatgggtcg
cagttaggagaagattttattcaattgcataaacttctaagaaagtccaccttcaaaaat
gcaaaactctatggtcctgatgttggtcagcctcgaagaaagacggctaagatgctgaag
agcttcctgaaggctggtggagaagtgattgattcagttacatggcatcactactatttg
aatggacggactgctaccaaggaagattttctaaaccctgatgtattggacatttttatt
tcatctgtgcaaaaagttttccaggtggttgagagcaccaggcctggcaagaaggtctgg
ttaggagaaacaagctctgcatatggaggcggagcgcccttgctatccgacacctttgca
gctggctttatgtggctggataaattgggcctgtcagcccgaatgggaatagaagtggtg
atgaggcaagtattctttggagcaggaaactaccatttagtggatgaaaacttcgatcct
ttacctgattattggctatctcttctgttcaagaaattggtgggcaccaaggtgttaatg
gcaagcgtgcaaggttcaaagagaaggaagcttcgagtataccttcattgcacaaacact
gacaatccaaggtataaagaaggagatttaactctgtatgccataaacctccataatgtc
accaagtacttgcggttaccctatcctttttctaacaagcaagtggataaataccttcta
agacctttgggacctcatggattactttccaaatctgtccaactcaatggtctaactcta
aagatggtggatgatcaaaccttgccacctttaatggaaaaacctctccggccaggaagt
tcactgggcttgccagctttctcatatagtttttttgtgataagaaatgccaaagttgct
gcttgcatctga

KEGG   Homo sapiens (human): 60495
Entry
60495             CDS       T01001                                 
Symbol
HPSE2, HPA2, HPR2, UFS, UFS1
Name
(RefSeq) heparanase 2 (inactive)
  KO
K07965  heparanase 2 [EC:3.2.1.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00531  Glycosaminoglycan degradation
hsa01100  Metabolic pathways
hsa05205  Proteoglycans in cancer
Module
hsa_M00078  Heparan sulfate degradation
Disease
H00753  Urofacial syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    60495 (HPSE2)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    60495 (HPSE2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    60495 (HPSE2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.-
     60495 (HPSE2)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Heparin
  Enzymes
   60495 (HPSE2)
SSDB
Motif
Pfam: Glyco_hydro_79n
Other DBs
NCBI-GeneID: 60495
NCBI-ProteinID: NP_068600
OMIM: 613469
HGNC: 18374
Ensembl: ENSG00000172987
Vega: OTTHUMG00000018880
Pharos: Q8WWQ2(Tbio)
UniProt: Q8WWQ2 Q2M1H9
LinkDB
Position
10:complement(98457077..99315951)
AA seq 592 aa
MRVLCAFPEAMPSSNSRPPACLAPGALYLALLLHLSLSSQAGDRRPLPVDRAAGLKEKTL
ILLDVSTKNPVRTVNENFLSLQLDPSIIHDGWLDFLSSKRLVTLARGLSPAFLRFGGKRT
DFLQFQNLRNPAKSRGGPGPDYYLKNYEDDIVRSDVALDKQKGCKIAQHPDVMLELQREK
AAQMHLVLLKEQFSNTYSNLILTARSLDKLYNFADCSGLHLIFALNALRRNPNNSWNSSS
ALSLLKYSASKKYNISWELGNEPNNYRTMHGRAVNGSQLGKDYIQLKSLLQPIRIYSRAS
LYGPNIGRPRKNVIALLDGFMKVAGSTVDAVTWQHCYIDGRVVKVMDFLKTRLLDTLSDQ
IRKIQKVVNTYTPGKKIWLEGVVTTSAGGTNNLSDSYAAGFLWLNTLGMLANQGIDVVIR
HSFFDHGYNHLVDQNFNPLPDYWLSLLYKRLIGPKVLAVHVAGLQRKPRPGRVIRDKLRI
YAHCTNHHNHNYVRGSITLFIINLHRSRKKIKLAGTLRDKLVHQYLLQPYGQEGLKSKSV
QLNGQPLVMVDDGTLPELKPRPLRAGRTLVIPPVTMGFYVVKNVNALACRYR
NT seq 1779 nt   +upstreamnt  +downstreamnt
atgagggtgctttgtgccttccctgaagccatgccctccagcaactcccgcccccccgcg
tgcctagccccgggggctctctacttggctctgttgctccatctctccctttcctcccag
gctggagacaggagacccttgcctgtagacagagctgcaggtttgaaggaaaagaccctg
attctacttgatgtgagcaccaagaacccagtcaggacagtcaatgagaacttcctctct
ctgcagctggatccgtccatcattcatgatggctggctcgatttcctaagctccaagcgc
ttggtgaccctggcccggggactttcgcccgcctttctgcgcttcgggggcaaaaggacc
gacttcctgcagttccagaacctgaggaacccggcgaaaagccgcgggggcccgggcccg
gattactatctcaaaaactatgaggatgacattgttcgaagtgatgttgccttagataaa
cagaaaggctgcaagattgcccagcaccctgatgttatgctggagctccaaagggagaag
gcagctcagatgcatctggttcttctaaaggagcaattctccaatacttacagtaatctc
atattaacagccaggtctctagacaaactttataactttgctgattgctctggactccac
ctgatatttgctctaaatgcactgcgtcgtaatcccaataactcctggaacagttctagt
gccctgagtctgttgaagtacagcgccagcaaaaagtacaacatttcttgggaactgggt
aatgagccaaataactatcggaccatgcatggccgggcagtaaatggcagccagttggga
aaggattacatccagctgaagagcctgttgcagcccatccggatttattccagagccagc
ttatatggccctaatattgggcggccgaggaagaatgtcatcgccctcctagatggattc
atgaaggtggcaggaagtacagtagatgcagttacctggcaacattgctacattgatggc
cgggtggtcaaggtgatggacttcctgaaaactcgcctgttagacacactctctgaccag
attaggaaaattcagaaagtggttaatacatacactccaggaaagaagatttggcttgaa
ggtgtggtgaccacctcagctggaggcacaaacaatctatccgattcctatgctgcagga
ttcttatggttgaacactttaggaatgctggccaatcagggcattgatgtcgtgatacgg
cactcattttttgaccatggatacaatcacctcgtggaccagaattttaacccattacca
gactactggctctctctcctctacaagcgcctgatcggccccaaagtcttggctgtgcat
gtggctgggctccagcggaagccacggcctggccgagtgatccgggacaaactaaggatt
tatgctcactgcacaaaccaccacaaccacaactacgttcgtgggtccattacacttttt
atcatcaacttgcatcgatcaagaaagaaaatcaagctggctgggactctcagagacaag
ctggttcaccagtacctgctgcagccctatgggcaggagggcctaaagtccaagtcagtg
caactgaatggccagcccttagtgatggtggacgacgggaccctcccagaattgaagccc
cgcccccttcgggccggccggacattggtcatccctccagtcaccatgggcttttatgtg
gtcaagaatgtcaatgctttggcctgccgctaccgataa

DBGET integrated database retrieval system