KEGG   Homo sapiens (human): 10870
Entry
10870             CDS       T01001                                 
Symbol
HCST, DAP10, KAP10, PIK3AP
Name
(RefSeq) hematopoietic cell signal transducer
  KO
K07988  hematopoietic cell signal transducer
Organism
hsa  Homo sapiens (human)
Pathway
hsa04650  Natural killer cell mediated cytotoxicity
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    10870 (HCST)
SSDB
Motif
Pfam: DAP10
Other DBs
NCBI-GeneID: 10870
NCBI-ProteinID: NP_055081
OMIM: 604089
HGNC: 16977
Ensembl: ENSG00000126264
Vega: OTTHUMG00000048132
Pharos: Q9UBK5(Tbio)
UniProt: Q9UBK5
LinkDB
Position
19:35902529..35904377
AA seq 93 aa
MIHLGHILFLLLLPVAAAQTTPGERSSLPAFYPGTSGSCSGCGSLSLPLLAGLVAADAVA
SLLIVGAVFLCARPRRSPAQEDGKVYINMPGRG
NT seq 282 nt   +upstreamnt  +downstreamnt
atgatccatctgggtcacatcctcttcctgcttttgctcccagtggctgcagctcagacg
actccaggagagagatcatcactccctgccttttaccctggcacttcaggctcttgttcc
ggatgtgggtccctctctctgccgctcctggcaggcctcgtggctgctgatgcggtggca
tcgctgctcatcgtgggggcggtgttcctgtgcgcacgcccacgccgcagccccgcccaa
gaagatggcaaagtctacatcaacatgccaggcaggggctga

DBGET integrated database retrieval system