KEGG   Homo sapiens (human): 10877
Entry
10877             CDS       T01001                                 

Gene name
CFHR4, CFHL4, FHR-4, FHR4
Definition
(RefSeq) complement factor H related 4
  KO
K23816  complement factor H-related protein 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04610  Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    10877 (CFHR4)
SSDB
Motif
Pfam: Sushi
Other DBs
NCBI-GeneID: 10877
NCBI-ProteinID: NP_001188479
OMIM: 605337
HGNC: 16979
Ensembl: ENSG00000134365
Vega: OTTHUMG00000036647
Pharos: Q92496(Tbio)
UniProt: Q92496
LinkDB
Position
1q31.3
AA seq 578 aa
MLLLINVILTLWVSCANGQEVKPCDFPEIQHGGLYYKSLRRLYFPAAAGQSYSYYCDQNF
VTPSGSYWDYIHCTQDGWSPTVPCLRTCSKSDVEIENGFISESSSIYILNEETQYNCKPG
YATAEGNSSGSITCLQNGWSTQPICIKFCDMPVFENSRAKSNGMWFKLHDTLDYECYDGY
ESSYGNTTDSIVCGEDGWSHLPTCYNSSENCGPPPPISNGDTTSFPQKVYLPWSRVEYQC
QSYYELQGSKYVTCSNGDWSEPPRCISMKPCEFPEIQHGHLYYENTRRPYFPVATGQSYS
YYCDQNFVTPSGSYWDYIHCTQDGWLPTVPCLRTCSKSDIEIENGFISESSSIYILNKEI
QYKCKPGYATADGNSSGSITCLQNGWSAQPICIKFCDMPVFENSRAKSNGMRFKLHDTLD
YECYDGYEISYGNTTGSIVCGEDGWSHFPTCYNSSEKCGPPPPISNGDTTSFLLKVYVPQ
SRVEYQCQSYYELQGSNYVTCSNGEWSEPPRCIHPCIITEENMNKNNIQLKGKSDIKYYA
KTGDTIEFMCKLGYNANTSVLSFQAVCREGIVEYPRCE
NT seq 1737 nt   +upstreamnt  +downstreamnt
atgttgttactaatcaatgtcattctgaccttgtgggtttcctgtgctaatggacaagaa
gtgaaaccttgtgattttccagaaattcaacatggaggtctatattataagagtttgcgt
agactatactttccagcagctgcaggacaatcttattcctattactgtgatcaaaatttt
gtgactccttcaggaagttactgggattacattcattgcacacaagatggttggtcacca
acggtcccatgcctcagaacatgctcaaaatcagatgtagaaattgaaaatggattcatt
tctgaatcttcctctatttatattttaaatgaagaaacacaatataattgtaaaccagga
tatgcaacagcagagggaaattcttcaggatcaattacatgtttgcaaaatggatggtca
acacaaccaatttgcattaaattttgtgatatgcctgtttttgagaattccagagccaag
agtaatggcatgtggtttaagctccatgacacattggactatgaatgctatgatggatat
gaaagcagttatggaaacaccacagattccatagtgtgtggtgaagatggctggtcccat
ttgccaacatgctataattcttcagaaaactgtgggcctcctccacctattagcaatgga
gataccacgtccttcccgcaaaaagtgtatctgccatggtcaagagtcgagtaccagtgc
cagtcctactatgaacttcagggttctaaatatgtaacatgtagtaatggagactggtca
gaaccaccaagatgcatatcaatgaaaccttgtgagtttccagaaattcaacatggacat
ctatattatgagaatacgcgtagaccatactttccagtagctacaggacaatcttactcc
tattactgtgaccaaaattttgtgactccttcaggaagttactgggattacattcactgc
acacaagatgggtggttgccaacagtcccatgcctcagaacatgctcaaaatcagatata
gaaattgaaaatggattcatttctgaatcttcctctatttatattttaaataaagaaata
caatataaatgtaaaccaggatatgcaacagcagatggaaattcttcaggttcaattaca
tgtttgcaaaatggatggtcagcacaaccaatttgcattaaattttgtgatatgcctgtt
tttgagaattccagagccaagagtaatggcatgcggtttaagctccatgacacattggac
tacgaatgctacgatggatatgaaatcagttatggaaacaccacaggttccatagtgtgt
ggtgaagatgggtggtcccatttcccaacatgttataattcttcagaaaagtgtgggcct
cctccacctattagcaatggtgataccacctcctttctactaaaagtgtatgtgccacag
tcaagagtcgagtaccaatgccagtcctactatgaacttcagggttctaattatgtaaca
tgtagtaatggagagtggtcggaaccaccaagatgcatacatccatgtataataactgaa
gaaaacatgaataaaaataacatacagttaaaaggaaaaagtgacataaaatattatgca
aaaacaggggataccattgaatttatgtgtaaattgggatataatgcgaatacatcagtt
ctatcatttcaagcagtgtgtagggaaggcatagtggaataccccagatgcgaataa

DBGET integrated database retrieval system