KEGG   Homo sapiens (human): 10893
Entry
10893             CDS       T01001                                 
Symbol
MMP24, MMP-24, MMP25, MT-MMP_5, MT-MMP5, MT5-MMP, MT5MMP, MTMMP5
Name
(RefSeq) matrix metallopeptidase 24
  KO
K08002  matrix metalloproteinase-24 (membrane-inserted) [EC:3.4.24.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04928  Parathyroid hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    10893 (MMP24)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    10893 (MMP24)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-
     10893 (MMP24)
Peptidases and inhibitors [BR:hsa01002]
 Metallo peptidases
  Family M10
   10893 (MMP24)
SSDB
Motif
Pfam: Peptidase_M10 Hemopexin DUF3377 PG_binding_1 Astacin Metallopep Peptidase_M66 DUF4953 Reprolysin_3 Reprolysin_4 Reprolysin_5
Other DBs
NCBI-GeneID: 10893
NCBI-ProteinID: NP_006681
OMIM: 604871
HGNC: 7172
Ensembl: ENSG00000125966
Pharos: Q9Y5R2(Tbio)
UniProt: Q9Y5R2 Q86VV6
LinkDB
Position
20:35226690..35276998
AA seq 645 aa
MPRSRGGRAAPGPPPPPPPPGQAPRWSRWRVPGRLLLLLLPALCCLPGAARAAAAAAGAG
NRAAVAVAVARADEAEAPFAGQNWLKSYGYLLPYDSRASALHSAKALQSAVSTMQQFYGI
PVTGVLDQTTIEWMKKPRCGVPDHPHLSRRRRNKRYALTGQKWRQKHITYSIHNYTPKVG
ELDTRKAIRQAFDVWQKVTPLTFEEVPYHEIKSDRKEADIMIFFASGFHGDSSPFDGEGG
FLAHAYFPGPGIGGDTHFDSDEPWTLGNANHDGNDLFLVAVHELGHALGLEHSSDPSAIM
APFYQYMETHNFKLPQDDLQGIQKIYGPPAEPLEPTRPLPTLPVRRIHSPSERKHERQPR
PPRPPLGDRPSTPGTKPNICDGNFNTVALFRGEMFVFKDRWFWRLRNNRVQEGYPMQIEQ
FWKGLPARIDAAYERADGRFVFFKGDKYWVFKEVTVEPGYPHSLGELGSCLPREGIDTAL
RWEPVGKTYFFKGERYWRYSEERRATDPGYPKPITVWKGIPQAPQGAFISKEGYYTYFYK
GRDYWKFDNQKLSVEPGYPRNILRDWMGCNQKEVERRKERRLPQDDVDIMVTINDVPGSV
NAVAVVIPCILSLCILVLVYTIFQFKNKTGPQPVTYYKRPVQEWV
NT seq 1938 nt   +upstreamnt  +downstreamnt
atgccgaggagccggggcggccgcgccgcgccggggccgccgccgccgccgccgccgccg
ggccaggccccgcgctggagccgctggcgggtccctgggcggctgctgctgctgctgctg
cccgcgctctgctgcctcccgggcgccgcgcgggcggcggcggcggcggcgggggcaggg
aaccgggcagcggtggcggtggcggtggcgcgggcggacgaggcggaggcgcccttcgcc
gggcagaactggttaaagtcctatggctatctgcttccctatgactcacgggcatctgcg
ctgcactcagcgaaggccttgcagtcggcagtctccactatgcagcagttttacgggatc
ccggtcaccggtgtgttggatcagacaacgatcgagtggatgaagaaaccccgatgtggt
gtccctgatcacccccacttaagccgtaggcggagaaacaagcgctatgccctgactgga
cagaagtggaggcaaaaacacatcacctacagcattcacaactataccccaaaagtgggt
gagctagacacgcggaaagctattcgccaggctttcgatgtgtggcagaaggtgacccca
ctgacctttgaagaggtgccataccatgagatcaaaagtgaccggaaggaggcagacatc
atgatcttttttgcttctggtttccatggcgacagctccccatttgatggagaaggggga
ttcctggcccatgcctacttccctggcccagggattggaggagacacccactttgactcc
gatgagccatggacgctaggaaatgccaaccatgacgggaacgacctcttcctggtggct
gtgcatgagctgggccacgcgctgggactggagcactccagcgaccccagcgccatcatg
gcgcccttctaccagtacatggagacgcacaacttcaagctgccccaggacgatctccag
ggcatccagaagatctatggacccccagccgagcctctggagcccacaaggccactccct
acactccccgtccgcaggatccactcaccatcggagaggaaacacgagcgccagcccagg
ccccctcggccgcccctcggggaccggccatccacaccaggcaccaaacccaacatctgt
gacggcaacttcaacacagtggccctcttccggggcgagatgtttgtctttaaggatcgc
tggttctggcgtctgcgcaataaccgagtgcaggagggctaccccatgcagatcgagcag
ttctggaagggcctgcctgcccgcatcgacgcagcctatgaaagggccgatgggagattt
gtcttcttcaaaggtgacaagtattgggtgtttaaggaggtgacggtggagcctgggtac
ccccacagcctgggggagctgggcagctgtttgccccgtgaaggcattgacacagctctg
cgctgggaacctgtgggcaagacctactttttcaaaggcgagcggtactggcgctacagc
gaggagcggcgggccacggaccctggctaccctaagcccatcaccgtgtggaagggcatc
ccacaggctccccaaggagccttcatcagcaaggaaggatattacacctatttctacaag
ggccgggactactggaagtttgacaaccagaaactgagcgtggagccaggctacccgcgc
aacatcctgcgtgactggatgggctgcaaccagaaggaggtggagcggcggaaggagcgg
cggctgccccaggacgacgtggacatcatggtgaccatcaacgatgtgccgggctccgtg
aacgccgtggccgtggtcatcccctgcatcctgtccctctgcatcctggtgctggtctac
accatcttccagttcaagaacaagacaggccctcagcctgtcacctactataagcggcca
gtccaggaatgggtgtga

KEGG   Homo sapiens (human): 4323
Entry
4323              CDS       T01001                                 
Symbol
MMP14, MMP-14, MMP-X1, MT-MMP, MT-MMP_1, MT1-MMP, MT1MMP, MTMMP1, WNCHRS
Name
(RefSeq) matrix metallopeptidase 14
  KO
K07763  matrix metalloproteinase-14 (membrane-inserted) [EC:3.4.24.80]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04668  TNF signaling pathway
hsa04912  GnRH signaling pathway
hsa04928  Parathyroid hormone synthesis, secretion and action
Disease
H02089  Winchester syndrome
Drug target
Prinomastat: D03797
Rebimastat: D03800
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    4323 (MMP14)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    4323 (MMP14)
   04928 Parathyroid hormone synthesis, secretion and action
    4323 (MMP14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    4323 (MMP14)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.80  membrane-type matrix metalloproteinase-1
     4323 (MMP14)
Peptidases and inhibitors [BR:hsa01002]
 Metallo peptidases
  Family M10
   4323 (MMP14)
SSDB
Motif
Pfam: Peptidase_M10 Hemopexin DUF3377 PG_binding_1 Astacin Metallopep Peptidase_M54 DUF4953 HTH_17 Peptidase_M66 Reprolysin_3 Reprolysin_5
Other DBs
NCBI-GeneID: 4323
NCBI-ProteinID: NP_004986
OMIM: 600754
HGNC: 7160
Ensembl: ENSG00000157227
Pharos: P50281(Tchem)
UniProt: P50281
Structure
LinkDB
Position
14:22836585..22847758
AA seq 582 aa
MSPAPRPPRCLLLPLLTLGTALASLGSAQSSSFSPEAWLQQYGYLPPGDLRTHTQRSPQS
LSAAIAAMQKFYGLQVTGKADADTMKAMRRPRCGVPDKFGAEIKANVRRKRYAIQGLKWQ
HNEITFCIQNYTPKVGEYATYEAIRKAFRVWESATPLRFREVPYAYIREGHEKQADIMIF
FAEGFHGDSTPFDGEGGFLAHAYFPGPNIGGDTHFDSAEPWTVRNEDLNGNDIFLVAVHE
LGHALGLEHSSDPSAIMAPFYQWMDTENFVLPDDDRRGIQQLYGGESGFPTKMPPQPRTT
SRPSVPDKPKNPTYGPNICDGNFDTVAMLRGEMFVFKERWFWRVRNNQVMDGYPMPIGQF
WRGLPASINTAYERKDGKFVFFKGDKHWVFDEASLEPGYPKHIKELGRGLPTDKIDAALF
WMPNGKTYFFRGNKYYRFNEELRAVDSEYPKNIKVWEGIPESPRGSFMGSDEVFTYFYKG
NKYWKFNNQKLKVEPGYPKSALRDWMGCPSGGRPDEGTEEETEVIIIEVDEEGGGAVSAA
AVVLPVLLLLLVLAVGLAVFFFRRHGTPRRLLYCQRSLLDKV
NT seq 1749 nt   +upstreamnt  +downstreamnt
atgtctcccgccccaagacccccccgttgtctcctgctccccctgctcacgctcggcacc
gcgctcgcctccctcggctcggcccaaagcagcagcttcagccccgaagcctggctacag
caatatggctacctgcctcccggggacctacgtacccacacacagcgctcaccccagtca
ctctcagcggccatcgctgccatgcagaagttttacggcttgcaagtaacaggcaaagct
gatgcagacaccatgaaggccatgaggcgcccccgatgtggtgttccagacaagtttggg
gctgagatcaaggccaatgttcgaaggaagcgctacgccatccagggtctcaaatggcaa
cataatgaaatcactttctgcatccagaattacacccccaaggtgggcgagtatgccaca
tacgaggccattcgcaaggcgttccgcgtgtgggagagtgccacaccactgcgcttccgc
gaggtgccctatgcctacatccgtgagggccatgagaagcaggccgacatcatgatcttc
tttgccgagggcttccatggcgacagcacgcccttcgatggtgagggcggcttcctggcc
catgcctacttcccaggccccaacattggaggagacacccactttgactctgccgagcct
tggactgtcaggaatgaggatctgaatggaaatgacatcttcctggtggctgtgcacgag
ctgggccatgccctggggctcgagcattccagtgacccctcggccatcatggcacccttt
taccagtggatggacacggagaattttgtgctgcccgatgatgaccgccggggcatccag
caactttatgggggtgagtcagggttccccaccaagatgccccctcaacccaggactacc
tcccggccttctgttcctgataaacccaaaaaccccacctatgggcccaacatctgtgac
gggaactttgacaccgtggccatgctccgaggggagatgtttgtcttcaaggagcgctgg
ttctggcgggtgaggaataaccaagtgatggatggatacccaatgcccattggccagttc
tggcggggcctgcctgcgtccatcaacactgcctacgagaggaaggatggcaaattcgtc
ttcttcaaaggagacaagcattgggtgtttgatgaggcgtccctggaacctggctacccc
aagcacattaaggagctgggccgagggctgcctaccgacaagattgatgctgctctcttc
tggatgcccaatggaaagacctacttcttccgtggaaacaagtactaccgtttcaacgaa
gagctcagggcagtggatagcgagtaccccaagaacatcaaagtctgggaagggatccct
gagtctcccagagggtcattcatgggcagcgatgaagtcttcacttacttctacaagggg
aacaaatactggaaattcaacaaccagaagctgaaggtagaaccgggctaccccaagtca
gccctgagggactggatgggctgcccatcgggaggccggccggatgaggggactgaggag
gagacggaggtgatcatcattgaggtggacgaggagggcggcggggcggtgagcgcggct
gccgtggtgctgcccgtgctgctgctgctcctggtgctggcggtgggccttgcagtcttc
ttcttcagacgccatgggacccccaggcgactgctctactgccagcgttccctgctggac
aaggtctga

KEGG   Homo sapiens (human): 4324
Entry
4324              CDS       T01001                                 
Symbol
MMP15, MMP-15, MT2-MMP, MT2MMP, MTMMP2, SMCP-2
Name
(RefSeq) matrix metallopeptidase 15
  KO
K07995  matrix metalloproteinase-15 (membrane-inserted) [EC:3.4.24.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04928  Parathyroid hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    4324 (MMP15)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    4324 (MMP15)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-
     4324 (MMP15)
Peptidases and inhibitors [BR:hsa01002]
 Metallo peptidases
  Family M10
   4324 (MMP15)
SSDB
Motif
Pfam: Peptidase_M10 Hemopexin DUF3377 PG_binding_1 Peptidase_M54 Reprolysin_3 DUF4953 Metallopep Peptidase_M66 PqiA Orbi_VP6
Other DBs
NCBI-GeneID: 4324
NCBI-ProteinID: NP_002419
OMIM: 602261
HGNC: 7161
Ensembl: ENSG00000102996
Pharos: P51511(Tchem)
UniProt: P51511 A0A024R6U8
LinkDB
Position
16:58025754..58046901
AA seq 669 aa
MGSDPSAPGRPGWTGSLLGDREEAARPRLLPLLLVLLGCLGLGVAAEDAEVHAENWLRLY
GYLPQPSRHMSTMRSAQILASALAEMQRFYGIPVTGVLDEETKEWMKRPRCGVPDQFGVR
VKANLRRRRKRYALTGRKWNNHHLTFSIQNYTEKLGWYHSMEAVRRAFRVWEQATPLVFQ
EVPYEDIRLRRQKEADIMVLFASGFHGDSSPFDGTGGFLAHAYFPGPGLGGDTHFDADEP
WTFSSTDLHGNNLFLVAVHELGHALGLEHSSNPNAIMAPFYQWKDVDNFKLPEDDLRGIQ
QLYGTPDGQPQPTQPLPTVTPRRPGRPDHRPPRPPQPPPPGGKPERPPKPGPPVQPRATE
RPDQYGPNICDGDFDTVAMLRGEMFVFKGRWFWRVRHNRVLDNYPMPIGHFWRGLPGDIS
AAYERQDGRFVFFKGDRYWLFREANLEPGYPQPLTSYGLGIPYDRIDTAIWWEPTGHTFF
FQEDRYWRFNEETQRGDPGYPKPISVWQGIPASPKGAFLSNDAAYTYFYKGTKYWKFDNE
RLRMEPGYPKSILRDFMGCQEHVEPGPRWPDVARPPFNPHGGAEPGADSAEGDVGDGDGD
FGAGVNKDGGSRVVVQMEEVARTVNVVMVLVPLLLLLCVLGLTYALVQMQRKGAPRVLLY
CKRSLQEWV
NT seq 2010 nt   +upstreamnt  +downstreamnt
atgggcagcgacccgagcgcgcccggacggccgggctggacgggcagcctcctcggcgac
cgggaggaggcggcgcggccgcgactgctgccgctgctcctggtgcttctgggctgcctg
ggccttggcgtagcggccgaagacgcggaggtccatgccgagaactggctgcggctttat
ggctacctgcctcagcccagccgccatatgtccaccatgcgttccgcccagatcttggcc
tcggcccttgcagagatgcagcgcttctacgggatcccagtcaccggtgtgctcgacgaa
gagaccaaggagtggatgaagcggccccgctgtggggtgccagaccagttcggggtacga
gtgaaagccaacctgcggcggcgtcggaagcgctacgccctcaccgggaggaagtggaac
aaccaccatctgacctttagcatccagaactacacggagaagttgggctggtaccactcg
atggaggcggtgcgcagggccttccgcgtgtgggagcaggccacgcccctggtcttccag
gaggtgccctatgaggacatccggctgcggcgacagaaggaggccgacatcatggtactc
tttgcctctggcttccacggcgacagctcgccgtttgatggcaccggtggctttctggcc
cacgcctatttccctggccccggcctaggcggggacacccattttgacgcagatgagccc
tggaccttctccagcactgacctgcatggaaacaacctcttcctggtggcagtgcatgag
ctgggccacgcgctggggctggagcactccagcaaccccaatgccatcatggcgccgttc
taccagtggaaggacgttgacaacttcaagctgcccgaggacgatctccgtggcatccag
cagctctacggtaccccagacggtcagccacagcctacccagcctctccccactgtgacg
ccacggcggccaggccggcctgaccaccggccgccccggcctccccagccaccaccccca
ggtgggaagccagagcggcccccaaagccgggccccccagtccagccccgagccacagag
cggcccgaccagtatggccccaacatctgcgacggggactttgacacagtggccatgctt
cgcggggagatgttcgtgttcaagggccgctggttctggcgagtccggcacaaccgcgtc
ctggacaactatcccatgcccatcgggcacttctggcgtggtctgcccggtgacatcagt
gctgcctacgagcgccaagacggtcgttttgtctttttcaaaggtgaccgctactggctc
tttcgagaagcgaacctggagcccggctacccacagccgctgaccagctatggcctgggc
atcccctatgaccgcattgacacggccatctggtgggagcccacaggccacaccttcttc
ttccaagaggacaggtactggcgcttcaacgaggagacacagcgtggagaccctgggtac
cccaagcccatcagtgtctggcaggggatccctgcctcccctaaaggggccttcctgagc
aatgacgcagcctacacctacttctacaagggcaccaaatactggaaattcgacaatgag
cgcctgcggatggagcccggctaccccaagtccatcctgcgggacttcatgggctgccag
gagcacgtggagccaggcccccgatggcccgacgtggcccggccgcccttcaacccccac
gggggtgcagagcccggggcggacagcgcagagggcgacgtgggggatggggatggggac
tttggggccggggtcaacaaggacgggggcagccgcgtggtggtgcagatggaggaggtg
gcacggacggtgaacgtggtgatggtgctggtgccactgctgctgctgctctgcgtcctg
ggcctcacctacgcgctggtgcagatgcagcgcaagggtgcgccacgtgtcctgctttac
tgcaagcgctcgctgcaggagtgggtctga

KEGG   Homo sapiens (human): 4325
Entry
4325              CDS       T01001                                 
Symbol
MMP16, C8orf57, MMP-X2, MT-MMP2, MT-MMP3, MT3-MMP
Name
(RefSeq) matrix metallopeptidase 16
  KO
K07996  matrix metalloproteinase-16 (membrane-inserted) [EC:3.4.24.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    4325 (MMP16)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    4325 (MMP16)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    4325 (MMP16)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-
     4325 (MMP16)
Peptidases and inhibitors [BR:hsa01002]
 Metallo peptidases
  Family M10
   4325 (MMP16)
SSDB
Motif
Pfam: Peptidase_M10 Hemopexin DUF3377 PG_binding_1 Astacin Peptidase_M66 Peptidase_M54 Metallopep Reprolysin_3 DUF4953
Other DBs
NCBI-GeneID: 4325
NCBI-ProteinID: NP_005932
OMIM: 602262
HGNC: 7162
Ensembl: ENSG00000156103
Pharos: P51512(Tchem)
UniProt: P51512
Structure
LinkDB
Position
8:complement(88032011..88327483)
AA seq 607 aa
MILLTFSTGRRLDFVHHSGVFFLQTLLWILCATVCGTEQYFNVEVWLQKYGYLPPTDPRM
SVLRSAETMQSALAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFHIRRKRY
ALTGQKWQHKHITYSIKNVTPKVGDPETRKAIRRAFDVWQNVTPLTFEEVPYSELENGKR
DVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDL
FLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYGPPDKIPPPT
RPLPTVPPHRSIPPADPRKNDRPKPPRPPTGRPSYPGAKPNICDGNFNTLAILRREMFVF
KDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENSDGNFVFFKGNKYWVFKDTTLQ
PGYPHDLITLGSGIPPHGIDSAIWWEDVGKTYFFKGDRYWRYSEEMKTMDPGYPKPITVW
KGIPESPQGAFVHKENGFTYFYKGKEYWKFNNQILKVEPGYPRSILKDFMGCDGPTDRVK
EGHSPPDDVDIVIKLDNTASTVKAIAIVIPCILALCLLVLVYTVFQFKRKGTPRHILYCK
RSMQEWV
NT seq 1824 nt   +upstreamnt  +downstreamnt
atgatcttactcacattcagcactggaagacggttggatttcgtgcatcattcgggggtg
tttttcttgcaaaccttgctttggattttatgtgctacagtctgcggaacggagcagtat
ttcaatgtggaggtttggttacaaaagtacggctaccttccaccgactgaccccagaatg
tcagtgctgcgctctgcagagaccatgcagtctgccctagctgccatgcagcagttctat
ggcattaacatgacaggaaaagtggacagaaacacaattgactggatgaagaagccccga
tgcggtgtacctgaccagacaagaggtagctccaaatttcatattcgtcgaaagcgatat
gcattgacaggacagaaatggcagcacaagcacatcacttacagtataaagaacgtaact
ccaaaagtaggagaccctgagactcgtaaagctattcgccgtgcctttgatgtgtggcag
aatgtaactcctctgacatttgaagaagttccctacagtgaattagaaaatggcaaacgt
gatgtggatataaccattatttttgcatctggtttccatggggacagctctccctttgat
ggagagggaggatttttggcacatgcctacttccctggaccaggaattggaggagatacc
cattttgactcagatgagccatggacactaggaaatcctaatcatgatggaaatgactta
tttcttgtagcagtccatgaactgggacatgctctgggattggagcattccaatgacccc
actgccatcatggctccattttaccagtacatggaaacagacaacttcaaactacctaat
gatgatttacagggcatccagaagatatatggtccacctgacaagattcctccacctaca
agacctctaccgacagtgcccccacaccgctctattcctccggctgacccaaggaaaaat
gacaggccaaaacctcctcggcctccaaccggcagaccctcctatcccggagccaaaccc
aacatctgtgatgggaactttaacactctagctattcttcgtcgtgagatgtttgttttc
aaggaccagtggttttggcgagtgagaaacaacagggtgatggatggatacccaatgcaa
attacttacttctggcggggcttgcctcctagtatcgatgcagtttatgaaaatagcgac
gggaattttgtgttctttaaaggtaacaaatattgggtgttcaaggatacaactcttcaa
cctggttaccctcatgacttgataacccttggaagtggaattccccctcatggtattgat
tcagccatttggtgggaggacgtcgggaaaacctatttcttcaagggagacagatattgg
agatatagtgaagaaatgaaaacaatggaccctggctatcccaagccaatcacagtctgg
aaagggatccctgaatctcctcagggagcatttgtacacaaagaaaatggctttacgtat
ttctacaaaggaaaggagtattggaaattcaacaaccagatactcaaggtagaacctgga
tatccaagatccatcctcaaggattttatgggctgtgatggaccaacagacagagttaaa
gaaggacacagcccaccagatgatgtagacattgtcatcaaactggacaacacagccagc
actgtgaaagccatagctattgtcattccctgcatcttggccttatgcctccttgtattg
gtttacactgtgttccagttcaagaggaaaggaacaccccgccacatactgtactgtaaa
cgctctatgcaagagtgggtgtga

KEGG   Homo sapiens (human): 4326
Entry
4326              CDS       T01001                                 
Symbol
MMP17, MMP-17, MT4-MMP, MT4MMP, MTMMP4
Name
(RefSeq) matrix metallopeptidase 17
  KO
K07997  matrix metalloproteinase-17 (membrane-inserted) [EC:3.4.24.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04928  Parathyroid hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    4326 (MMP17)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    4326 (MMP17)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-
     4326 (MMP17)
Peptidases and inhibitors [BR:hsa01002]
 Metallo peptidases
  Family M10
   4326 (MMP17)
SSDB
Motif
Pfam: Peptidase_M10 Hemopexin PG_binding_1 Peptidase_M66
Other DBs
NCBI-GeneID: 4326
NCBI-ProteinID: NP_057239
OMIM: 602285
HGNC: 7163
Ensembl: ENSG00000198598
Pharos: Q9ULZ9(Tchem)
UniProt: Q9ULZ9
LinkDB
Position
12:131828393..131851771
AA seq 603 aa
MRRRAARGPGPPPPGPGLSRLPLPLLLLLALGTRGGCAAPAPAPRAEDLSLGVEWLSRFG
YLPPADPTTGQLQTQEELSKAITAMQQFGGLEATGILDEATLALMKTPRCSLPDLPVLTQ
ARRRRQAPAPTKWNKRNLSWRVRTFPRDSPLGHDTVRALMYYALKVWSDIAPLNFHEVAG
SAADIQIDFSKADHNDGYPFDGPGGTVAHAFFPGHHHTAGDTHFDDDEAWTFRSSDAHGM
DLFAVAVHEFGHAIGLSHVAAAHSIMRPYYQGPVGDPLRYGLPYEDKVRVWQLYGVRESV
SPTAQPEEPPLLPEPPDNRSSAPPRKDVPHRCSTHFDAVAQIRGEAFFFKGKYFWRLTRD
RHLVSLQPAQMHRFWRGLPLHLDSVDAVYERTSDHKIVFFKGDRYWVFKDNNVEEGYPRP
VSDFSLPPGGIDAAFSWAHNDRTYFFKDQLYWRYDDHTRHMDPGYPAQSPLWRGVPSTLD
DAMRWSDGASYFFRGQEYWKVLDGELEVAPGYPQSTARDWLVCGDSQADGSVAAGVDAAE
GPRAPPGQHDQSRSEDGYEVCSCTSGASSPPGAPGPLVAATMLLLLPPLSPGALWTAAQA
LTL
NT seq 1812 nt   +upstreamnt  +downstreamnt
atgcggcgccgcgcagcccggggacccggcccgccgcccccagggcccggactctcgcgg
ctgccgctgccgctgctgctgctgctggcgctggggacccgcgggggctgcgccgcgccc
gcacccgcgccgcgcgccgaggacctcagcctgggagtggagtggctaagcaggttcggt
tacctgcccccggctgaccccacaacagggcagctgcagacgcaagaggagctgtctaag
gccatcacagccatgcagcagtttggtggcctggaggccaccggcatcctggacgaggcc
accctggccctgatgaaaaccccacgctgctccctgccagacctccctgtcctgacccag
gctcgcaggagacgccaggctccagcccccaccaagtggaacaagaggaacctgtcgtgg
agggtccggacgttcccacgggactcaccactggggcacgacacggtgcgtgcactcatg
tactacgccctcaaggtctggagcgacattgcgcccctgaacttccacgaggtggcgggc
agcgccgccgacatccagatcgacttctccaaggccgaccataacgacggctaccccttc
gacggccccggcggcaccgtggcccacgccttcttccccggccaccaccacaccgccggg
gacacccactttgacgatgacgaggcctggaccttccgctcctcggatgcccacgggatg
gacctgtttgcagtggctgtccacgagtttggccacgccattgggttaagccatgtggcc
gctgcacactccatcatgcggccgtactaccagggcccggtgggtgacccgctgcgctac
gggctcccctacgaggacaaggtgcgcgtctggcagctgtacggtgtgcgggagtctgtg
tctcccacggcgcagcccgaggagcctcccctgctgccggagcccccagacaaccggtcc
agcgccccgcccaggaaggacgtgccccacagatgcagcactcactttgacgcggtggcc
cagatccggggtgaagctttcttcttcaaaggcaagtacttctggcggctgacgcgggac
cggcacctggtgtccctgcagccggcacagatgcaccgcttctggcggggcctgccgctg
cacctggacagcgtggacgccgtgtacgagcgcaccagcgaccacaagatcgtcttcttt
aaaggagacaggtactgggtgttcaaggacaataacgtagaggaaggatacccgcgcccc
gtctccgacttcagcctcccgcctggcggcatcgacgctgccttctcctgggcccacaat
gacaggacttatttctttaaggaccagctgtactggcgctacgatgaccacacgaggcac
atggaccccggctaccccgcccagagccccctgtggaggggtgtccccagcacgctggac
gacgccatgcgctggtccgacggtgcctcctacttcttccgtggccaggagtactggaaa
gtgctggatggcgagctggaggtggcacccgggtacccacagtccacggcccgggactgg
ctggtgtgtggagactcacaggccgatggatctgtggctgcgggcgtggacgcggcagag
gggccccgcgcccctccaggacaacatgaccagagccgctcggaggacggttacgaggtc
tgctcatgcacctctggggcatcctctcccccgggggccccaggcccactggtggctgcc
accatgctgctgctgctgccgccactgtcaccaggcgccctgtggacagcggcccaggcc
ctgacgctatga

KEGG   Homo sapiens (human): 64386
Entry
64386             CDS       T01001                                 
Symbol
MMP25, MMP-25, MMP20, MMP20A, MMPL1, MT-MMP_6, MT-MMP6, MT6-MMP, MT6MMP, MTMMP6
Name
(RefSeq) matrix metallopeptidase 25
  KO
K08003  matrix metalloproteinase-25 (membrane-inserted) [EC:3.4.24.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04928  Parathyroid hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    64386 (MMP25)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    64386 (MMP25)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-
     64386 (MMP25)
Peptidases and inhibitors [BR:hsa01002]
 Metallo peptidases
  Family M10
   64386 (MMP25)
SSDB
Motif
Pfam: Peptidase_M10 Hemopexin PG_binding_1 Peptidase_M66 Metallopep Astacin Reprolysin_4 Reprolysin_3
Other DBs
NCBI-GeneID: 64386
NCBI-ProteinID: NP_071913
OMIM: 608482
HGNC: 14246
Ensembl: ENSG00000008516
Pharos: Q9NPA2(Tchem)
UniProt: Q9NPA2
LinkDB
Position
16:3046561..3060726
AA seq 562 aa
MRLRLRLLALLLLLLAPPARAPKPSAQDVSLGVDWLTRYGYLPPPHPAQAQLQSPEKLRD
AIKVMQRFAGLPETGRMDPGTVATMRKPRCSLPDVLGVAGLVRRRRRYALSGSVWKKRTL
TWRVRSFPQSSQLSQETVRVLMSYALMAWGMESGLTFHEVDSPQGQEPDILIDFARAFHQ
DSYPFDGLGGTLAHAFFPGEHPISGDTHFDDEETWTFGSKDGEGTDLFAVAVHEFGHALG
LGHSSAPNSIMRPFYQGPVGDPDKYRLSQDDRDGLQQLYGKAPQTPYDKPTRKPLAPPPQ
PPASPTHSPSFPIPDRCEGNFDAIANIRGETFFFKGPWFWRLQPSGQLVSPRPARLHRFW
EGLPAQVRVVQAAYARHRDGRILLFSGPQFWVFQDRQLEGGARPLTELGLPPGEEVDAVF
SWPQNGKTYLVRGRQYWRYDEAAARPDPGYPRDLSLWEGAPPSPDDVTVSNAGDTYFFKG
AHYWRFPKNSIKTEPDAPQPMGPNWLDCPAPSSGPRAPRPPKATPVSETCDCQCELNQAA
GRWPAPIPLLLLPLLVGGVASR
NT seq 1689 nt   +upstreamnt  +downstreamnt
atgcggctgcggctccggcttctggcgctgctgcttctgctgctggcaccgcccgcgcgc
gccccgaagccctcggcgcaggacgtgagcctgggcgtggactggctgactcgctatggt
tacctgccgccaccccaccctgcccaggcccagctgcagagccctgagaagttgcgcgat
gccatcaaagtcatgcagaggttcgcggggctgccggagaccggccgcatggacccaggg
acagtggccaccatgcgtaagccccgctgctccctgcctgacgtgctgggggtggcgggg
ctggtcaggcggcgtcgccggtacgctctgagcggcagcgtgtggaagaagcgaaccctg
acatggagggtacgttccttcccccagagctcccagctgagccaggagaccgtgcgggtc
ctcatgagctatgccctgatggcctggggcatggagtcaggcctcacatttcatgaggtg
gattccccccagggccaggagcccgacatcctcatcgactttgcccgcgccttccaccag
gacagctaccccttcgacgggttggggggcaccctagcccatgccttcttccctggggag
caccccatctccggggacactcactttgacgatgaggagacctggacttttgggtcaaaa
gacggcgaggggaccgacctgtttgccgtggctgtccatgagtttggccacgccctgggc
ctgggccactcctcagcccccaactccattatgaggcccttctaccagggtccggtgggc
gaccctgacaagtaccgcctgtctcaggatgaccgcgatggcctgcagcaactctatggg
aaggcgccccaaaccccatatgacaagcccacaaggaaacccctggctcctccgccccag
cccccggcctcgcccacacacagcccatccttccccatccctgatcgatgtgagggcaat
tttgacgccatcgccaacatccgaggggaaactttcttcttcaaaggcccctggttctgg
cgcctccagccctccggacagctggtgtccccgcgacccgcacggctgcaccgcttctgg
gaggggctgcccgcccaggtgagggtggtgcaggccgcctatgctcggcaccgagacggc
cgaatcctcctctttagcgggccccagttctgggtgttccaggaccggcagctggagggc
ggggcgcggccgctcacggagctggggctgcccccgggagaggaggtggacgccgtgttc
tcgtggccacagaacgggaagacctacctggtccgcggccggcagtactggcgctacgac
gaggcggcggcgcgcccggaccccggctaccctcgcgacctgagcctctgggaaggcgcg
cccccctcccctgacgatgtcaccgtcagcaacgcaggtgacacctacttcttcaagggc
gcccactactggcgcttccccaagaacagcatcaagaccgagccggacgccccccagccc
atggggcccaactggctggactgccccgccccgagctctggtccccgcgcccccaggccc
cccaaagcgacccccgtgtccgaaacctgcgattgtcagtgcgagctcaaccaggccgca
ggacgttggcctgctcccatcccgctgctcctcttgcccctgctggtggggggtgtagcc
tcccgctga

DBGET integrated database retrieval system