KEGG   Homo sapiens (human): 10898
Entry
10898             CDS       T01001                                 
Symbol
CPSF4, CPSF30, NAR, NEB-1, NEB1
Name
(RefSeq) cleavage and polyadenylation specific factor 4
  KO
K14404  cleavage and polyadenylation specificity factor subunit 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa03015  mRNA surveillance pathway
hsa05164  Influenza A
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    10898 (CPSF4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    10898 (CPSF4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    10898 (CPSF4)
   03019 Messenger RNA biogenesis [BR:hsa03019]
    10898 (CPSF4)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     10898 (CPSF4)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     10898 (CPSF4)
SSDB
Motif
Pfam: zf-CCCH zf_CCCH_4 zf-CCCH_3 Torus zf-CCCH_4 zf-CCHC zf-CCCH_2 zf-C3H1
Other DBs
NCBI-GeneID: 10898
NCBI-ProteinID: NP_006684
OMIM: 603052
HGNC: 2327
Ensembl: ENSG00000160917
Vega: OTTHUMG00000154599
Pharos: O95639(Tbio)
UniProt: O95639
Structure
LinkDB
Position
7:99438943..99457373
AA seq 269 aa
MQEIIASVDHIKFDLEIAVEQQLGAQPLPFPGMDKSGAAVCEFFLKAACGKGGMCPFRHI
SGEKTVVCKHWLRGLCKKGDQCEFLHEYDMTKMPECYFYSKFGECSNKECPFLHIDPESK
IKDCPWYDRGFCKHGPLCRHRHTRRVICVNYLVGFCPEGPSCKFMHPRFELPMGTTEQPP
LPQQTQPPAKQSNNPPLQRSSSLIQLTSQNSSPNQQRTPQVIGVMQSQNSSAGNRGPRPL
EQVTCYKCGEKGHYANRCTKGHLAFLSGQ
NT seq 810 nt   +upstreamnt  +downstreamnt
atgcaggaaatcatcgccagcgtggaccacatcaagtttgacttggagatcgcggtggag
cagcagctgggggcgcagccgctgcccttccccggcatggacaagtcgggcgctgctgtc
tgtgaattctttttgaaagctgcctgcggcaaagggggcatgtgtccgtttcgccacatc
agtggtgagaagacagttgtgtgcaaacactggctgcgtggcctatgcaagaaaggggac
cagtgtgagttcctgcatgagtatgacatgaccaagatgcccgagtgctacttctactcc
aagttcggggagtgcagcaacaaggaatgtcccttcctgcacatcgaccccgagtccaag
atcaaggactgtccttggtatgaccgtggcttctgcaagcacggtcccctctgcaggcac
cggcacacacggagagtcatctgtgtgaattacctcgtgggattctgcccggaggggccc
tcgtgtaaattcatgcaccctcgatttgaactgcccatgggaaccaccgagcagccccca
ctgccgcagcagacacagcctccagcaaagcaaagtaacaatccgccattacaaaggtcg
tcctccttgatccagttaacgagtcagaactcttctcccaatcagcagagaaccccgcag
gtcatcggggtcatgcagagtcaaaacagcagcgcgggcaaccggggaccccggccactg
gagcaggtcacctgttacaagtgtggcgagaaaggacactacgccaacagatgcaccaaa
gggcacttggcctttctcagtggacagtga

KEGG   Homo sapiens (human): 642843
Entry
642843            CDS       T01001                                 
Symbol
CPSF4L
Name
(RefSeq) cleavage and polyadenylation specific factor 4 like
  KO
K14404  cleavage and polyadenylation specificity factor subunit 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa03015  mRNA surveillance pathway
hsa05164  Influenza A
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    642843 (CPSF4L)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    642843 (CPSF4L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    642843 (CPSF4L)
   03019 Messenger RNA biogenesis [BR:hsa03019]
    642843 (CPSF4L)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     642843 (CPSF4L)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     642843 (CPSF4L)
SSDB
Motif
Pfam: zf-CCCH zf_CCCH_4 Torus zf-CCCH_3 zf-CCCH_4 zf-CCCH_2
Other DBs
NCBI-GeneID: 642843
NCBI-ProteinID: NP_001123357
HGNC: 33632
Ensembl: ENSG00000187959
Vega: OTTHUMG00000132640
Pharos: A6NMK7(Tdark)
UniProt: A6NMK7
LinkDB
Position
17:complement(73242101..73263778)
AA seq 179 aa
MQEVIAGLERFTFAFEKDVEMQKGTGLLPFQGMDKSASAVCNFFTKGLCEKGKLCPFRHD
RGEKMVVCKHWLRGLCKKGDHCKFLHQYDLTRMPECYFYSKFGDCSNKECSFLHVKPAFK
SQDCPWYDQGFCKDGPLCKYRHVPRIMCLNYLVGFCPEGPKCQFAQKIREFKLLPGSKI
NT seq 540 nt   +upstreamnt  +downstreamnt
atgcaagaggtcattgcggggctagagcggttcacctttgccttcgagaaggatgtcgag
atgcagaagggcactgggctcctgcctttccagggcatggacaagtcggcctcagctgtg
tgcaacttcttcactaaagggctctgtgagaaagggaaactctgccccttccgacatgac
cgaggggagaagatggtggtatgcaagcactggctccgggggctctgcaagaagggtgat
cactgcaagttcctgcaccagtatgacctcaccaggatgcctgagtgctacttctactcc
aagtttggtgactgcagcaacaaggagtgttccttcctccatgtgaagccagctttcaag
tcccaggactgtccttggtatgaccaaggtttctgcaaggacggtcctctgtgtaaatac
cgccatgtccccagaataatgtgtctcaactatttagttggcttctgccccgagggaccc
aagtgccaatttgctcagaagattcgggaattcaagctgctgcctggaagcaagatctaa

DBGET integrated database retrieval system