KEGG   Homo sapiens (human): 10915
Entry
10915             CDS       T01001                                 
Symbol
TCERG1, CA150, TAF2S, Urn1
Name
(RefSeq) transcription elongation regulator 1
  KO
K12824  transcription elongation regulator 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    10915 (TCERG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    10915 (TCERG1)
Spliceosome [BR:hsa03041]
 Complex A
  U1 snRNP components
   U1 related factors
    10915 (TCERG1)
 Complex B
    10915 (TCERG1)
SSDB
Motif
Pfam: FF WW RhoGAP-FF1
Other DBs
NCBI-GeneID: 10915
NCBI-ProteinID: NP_006697
OMIM: 605409
HGNC: 15630
Ensembl: ENSG00000113649
Pharos: O14776(Tbio)
UniProt: O14776
Structure
LinkDB
Position
5:146447330..146511961
AA seq 1098 aa
MAERGGDGGESERFNPGELRMAQQQALRFRGPAPPPNAVMRGPPPLMRPPPPFGMMRGPP
PPPRPPFGRPPFDPNMPPMPPPGGIPPPMGPPHLQRPPFMPPPMSSMPPPPGMMFPPGMP
PVTAPGTPALPPTEEIWVENKTPDGKVYYYNARTRESAWTKPDGVKVIQQSELTPMLAAQ
AQVQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQ
AQVQAQVQAQVQAQAVGASTPTTSSPAPAVSTSTSSSTPSSTTSTTTTATSVAQTVSTPT
TQDQTPSSAVSVATPTVSVSTPAPTATPVQTVPQPHPQTLPPAVPHSVPQPTTAIPAFPP
VMVPPFRVPLPGMPIPLPGVAMMQIVSCPYVKTVATTKTGVLPGMAPPIVPMIHPQVAIA
ASPATLAGATAVSEWTEYKTADGKTYYYNNRTLESTWEKPQELKEKEKLEEKIKEPIKEP
SEEPLPMETEEEDPKEEPIKEIKEEPKEEEMTEEEKAAQKAKPVATAPIPGTPWCVVWTG
DERVFFYNPTTRLSMWDRPDDLIGRADVDKIIQEPPHKKGMEELKKLRHPTPTMLSIQKW
QFSMSAIKEEQELMEEINEDEPVKAKKRKRDDNKDIDSEKEAAMEAEIKAARERAIVPLE
ARMKQFKDMLLERGVSAFSTWEKELHKIVFDPRYLLLNPKERKQVFDQYVKTRAEEERRE
KKNKIMQAKEDFKKMMEEAKFNPRATFSEFAAKHAKDSRFKAIEKMKDREALFNEFVAAA
RKKEKEDSKTRGEKIKSDFFELLSNHHLDSQSRWSKVKDKVESDPRYKAVDSSSMREDLF
KQYIEKIAKNLDSEKEKELERQARIEASLREREREVQKARSEQTKEIDREREQHKREEAI
QNFKALLSDMVRSSDVSWSDTRRTLRKDHRWESGSLLEREEKEKLFNEHIEALTKKKREH
FRQLLDETSAITLTSTWKEVKKIIKEDPRCIKFSSSDRKKQREFEEYIRDKYITAKADFR
TLLKETKFITYRSKKLIQESDQHLKDVEKILQNDKRYLVLDCVPEERRKLIVAYVDDLDR
RGPPPPPTASEPTRRSTK
NT seq 3297 nt   +upstreamnt  +downstreamnt
atggcggagcgtggcggggacgggggcgagagtgaacgattcaacccgggggagctcagg
atggcccaacagcaggccttgaggttccgaggtccggctcccccaccaaatgcagtgatg
cgaggcccaccacctctgatgcgacctcctccaccttttggtatgatgcgaggccctcct
ccaccaccacggccgccctttggacgtcctccttttgatcctaatatgccgccaatgcct
cctccaggagggatacctccacctatgggccctccacacctccagagaccacctttcatg
cctcctcccatgagttccatgcctcctcctccgggtatgatgtttccaccaggaatgcct
cctgtgactgctcctggtactccagcactacctcctacggaggagatatgggttgaaaat
aaaactccagatgggaaggtttattattataatgctcggacacgtgaatctgcatggacc
aagccagatggagttaaggttattcagcaatcagaactgacacctatgcttgcagcccag
gcacaggttcaggctcaggcccaggcgcaggctcaggcccaggcgcaggctcaggcccag
gcacaagctcaggcccaggctcaggctcaggcccaggcccaggcccaggcccaggcccag
gcccaagcccaagcccaggcccaggctcaggctcaggcacaagctcaggcccaggcccag
gctcaggtccaggcccaggtccaggcacaagtgcaagcacaagcagttggagcttccacc
cctacgaccagtagcccagcacctgcagtatccacttcaacatcatcatccaccccttcc
tctaccacttctaccacaacaactgctacttcagttgcgcagacagtatcaacacccaca
acacaagatcagaccccaagttctgctgtttcagttgccacgcctacagttagtgtttca
actcctgctcctacagccacacctgtgcaaaccgttccccagccgcaccctcagacgtta
cctcctgctgttcctcattcagtacctcagccaacaacagcaatacctgcttttccacca
gtaatggtacctccgtttcgtgttccccttcctggcatgccaattccacttccaggtgta
gcaatgatgcaaatagtcagctgcccgtatgtaaagacagtcgctaccaccaagaccggt
gtattgccaggaatggcccctcctatcgtacccatgatacatccccaggttgctattgca
gcttcacctgctaccttagctggagcaacagcagtttctgaatggactgaatataaaaca
gcagatgggaagacatattattataataatagaacattagaatcaacctgggaaaaaccc
caagaactaaaggaaaaagaaaagttagaagagaagattaaagagccaattaaagaaccc
tctgaagagcctctgccaatggagacggaggaggaggatcctaaagaagagcctataaag
gagataaaggaggagcccaaagaagaggagatgactgaagaagaaaaggctgcccagaag
gcaaagccagttgctactgctcctattcctggtactccatggtgtgtcgtttggactggt
gatgagcgggtcttcttttataatcccaccactcgtctttctatgtgggaccgacctgat
gatctgattggcagggcagatgttgacaaaattattcaggagccccctcataaaaaagga
atggaggaattgaagaaactaaggcacccaactccgacaatgctgtcgatccaaaagtgg
caattctctatgagtgcaattaaagaggaacaagaattaatggaagaaattaatgaagat
gagcctgttaaagcaaaaaaacggaagagagacgataataaagacattgactcagagaaa
gaagctgccatggaagctgaaattaaagctgcccgagaaagggccattgtccctctggag
gctcgaatgaagcagttcaaggacatgctgctagagagaggggtgtctgctttttcaacg
tgggagaaggagttgcacaagatagtttttgatccccggtacttacttctcaatcctaaa
gagagaaaacaggtgtttgatcagtatgtaaagaccagggcagaggaagaacgcagggaa
aagaaaaataaaataatgcaagccaaggaagatttcaaaaaaatgatggaagaagcaaaa
tttaatccaagagcaacttttagtgaatttgcagccaagcatgctaaagattcaagattc
aaagcaattgaaaagatgaaagaccgagaagccttgtttaatgagtttgtggccgctgct
aggaagaaagagaaagaagattcgaagaccagaggtgagaagattaaatcggatttcttt
gaactattatctaatcatcacttggacagtcagtctcgatggagcaaagtaaaagacaaa
gtagaaagtgatccacgttacaaagcagtagatagttcatcaatgagagaagaccttttc
aaacagtacattgaaaaaatagccaagaatttagactcagaaaaagaaaaggagcttgaa
aggcaagcccgcattgaggcaagccttcgagaacgagaaagggaggttcaaaaggcccgt
tcagaacaaacaaaagaaatagatcgagagagagagcagcacaaacgagaagaagctatc
cagaatttcaaagctcttctgtctgacatggtacgttcttcagatgtgtcatggtctgat
actcgtaggaccctccgaaaagatcaccgctgggaatctggatccttattggaaagagag
gagaaagagaagctttttaatgaacacattgaagcacttaccaaaaaaaagagagagcac
tttaggcaacttctggatgaaacttctgcaattaccttaacatccacgtggaaagaagta
aaaaaaatcattaaggaagatcctcgatgtattaagttctcctccagtgacaggaaaaaa
caaagagaatttgaagaatatatcagagacaaatatatcacagccaaagctgacttcagg
acgcttttgaaagagaccaaatttataacatatagatccaaaaaattaatccaagaatca
gatcagcacctgaaagatgtagaaaaaattttacagaatgacaaacggtatctagtactg
gactgtgtgccagaggagaggcgtaaactgattgtggcatatgttgatgacctggatcgc
cggggtccacccccacctcccacagcatcggagcccacgagacgatcaacaaaataa

DBGET integrated database retrieval system