KEGG   Homo sapiens (human): 11009
Entry
11009             CDS       T01001                                 
Symbol
IL24, C49A, FISP, IL10B, MDA7, MOB5, ST16
Name
(RefSeq) interleukin 24
  KO
K22668  interleukin 24
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04630  JAK-STAT signaling pathway
Network
nt06150  Cytokine-cytokine receptor interaction (viruses)
  Element
N01271  IL19/20/24 to IL20R signaling
N01273  IL20/24 to IL20R/22R signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    11009 (IL24)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    11009 (IL24)
   04061 Viral protein interaction with cytokine and cytokine receptor
    11009 (IL24)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    11009 (IL24)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Interleukins
   11009 (IL24)
SSDB
Motif
Pfam: IL22 IL10
Other DBs
NCBI-GeneID: 11009
NCBI-ProteinID: NP_006841
OMIM: 604136
HGNC: 11346
Ensembl: ENSG00000162892
Pharos: Q13007(Tbio)
UniProt: Q13007
Structure
LinkDB
Position
1:206897443..206904139
AA seq 206 aa
MNFQQRLQSLWTLARPFCPPLLATASQMQMVVLPCLGFTLLLWSQVSGAQGQEFHFGPCQ
VKGVVPQKLWEAFWAVKDTMQAQDNITSARLLQQEVLQNVSDAESCYLVHTLLEFYLKTV
FKNYHNRTVEVRTLKSFSTLANNFVLIVSQLQPSQENEMFSIRDSAHRRFLLFRRAFKQL
DVEAALTKALGEVDILLTWMQKFYKL
NT seq 621 nt   +upstreamnt  +downstreamnt
atgaattttcaacagaggctgcaaagcctgtggactttagccagacccttctgccctcct
ttgctggcgacagcctctcaaatgcagatggttgtgctcccttgcctgggttttaccctg
cttctctggagccaggtatcaggggcccagggccaagaattccactttgggccctgccaa
gtgaagggggttgttccccagaaactgtgggaagccttctgggctgtgaaagacactatg
caagctcaggataacatcacgagtgcccggctgctgcagcaggaggttctgcagaacgtc
tcggatgctgagagctgttaccttgtccacaccctgctggagttctacttgaaaactgtt
ttcaaaaactaccacaatagaacagttgaagtcaggactctgaagtcattctctactctg
gccaacaactttgttctcatcgtgtcacaactgcaacccagtcaagaaaatgagatgttt
tccatcagagacagtgcacacaggcggtttctgctattccggagagcattcaaacagttg
gacgtagaagcagctctgaccaaagcccttggggaagtggacattcttctgacctggatg
cagaaattctacaagctctga

KEGG   Homo sapiens (human): 1437
Entry
1437              CDS       T01001                                 
Symbol
CSF2, CSF, GMCSF
Name
(RefSeq) colony stimulating factor 2
  KO
K05427  granulocyte-macrophage colony-stimulating factor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04630  JAK-STAT signaling pathway
hsa04640  Hematopoietic cell lineage
hsa04650  Natural killer cell mediated cytotoxicity
hsa04657  IL-17 signaling pathway
hsa04660  T cell receptor signaling pathway
hsa04664  Fc epsilon RI signaling pathway
hsa04668  TNF signaling pathway
hsa05131  Shigellosis
hsa05146  Amoebiasis
hsa05166  Human T-cell leukemia virus 1 infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05171  Coronavirus disease - COVID-19
hsa05202  Transcriptional misregulation in cancer
hsa05221  Acute myeloid leukemia
hsa05323  Rheumatoid arthritis
Network
nt06240  Transcription
nt06275  Acute myeloid leukemia
  Element
N00116  Mutation-inactivated RUNX1 to transcription
N00118  TEL-AML1 fusion to transcriptional repression
Drug target
Gimsilumab: D11121
Lenzilumab: D11236
Otilimab: D11343
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    1437 (CSF2)
   04668 TNF signaling pathway
    1437 (CSF2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    1437 (CSF2)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    1437 (CSF2)
   04650 Natural killer cell mediated cytotoxicity
    1437 (CSF2)
   04660 T cell receptor signaling pathway
    1437 (CSF2)
   04657 IL-17 signaling pathway
    1437 (CSF2)
   04664 Fc epsilon RI signaling pathway
    1437 (CSF2)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    1437 (CSF2)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    1437 (CSF2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    1437 (CSF2)
   05171 Coronavirus disease - COVID-19
    1437 (CSF2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    1437 (CSF2)
  09171 Infectious disease: bacterial
   05131 Shigellosis
    1437 (CSF2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    1437 (CSF2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    1437 (CSF2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    1437 (CSF2)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    1437 (CSF2)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    1437 (CSF2)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA degradation factors
   3'-5' decay
    Other 3'-5' decay factors
     1437 (CSF2)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  CSF and other factors
   1437 (CSF2)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Heparin
  Cytokines
   1437 (CSF2)
SSDB
Motif
Pfam: GM_CSF
Other DBs
NCBI-GeneID: 1437
NCBI-ProteinID: NP_000749
OMIM: 138960
HGNC: 2434
Ensembl: ENSG00000164400
Pharos: P04141(Tbio)
UniProt: P04141
Structure
LinkDB
Position
5:132073789..132076170
AA seq 144 aa
MWLQSLLLLGTVACSISAPARSPSPSTQPWEHVNAIQEARRLLNLSRDTAAEMNETVEVI
SEMFDLQEPTCLQTRLELYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITF
ESFKENLKDFLLVIPFDCWEPVQE
NT seq 435 nt   +upstreamnt  +downstreamnt
atgtggctgcagagcctgctgctcttgggcactgtggcctgcagcatctctgcacccgcc
cgctcgcccagccccagcacgcagccctgggagcatgtgaatgccatccaggaggcccgg
cgtctcctgaacctgagtagagacactgctgctgagatgaatgaaacagtagaagtcatc
tcagaaatgtttgacctccaggagccgacctgcctacagacccgcctggagctgtacaag
cagggcctgcggggcagcctcaccaagctcaagggccccttgaccatgatggccagccac
tacaagcagcactgccctccaaccccggaaacttcctgtgcaacccagattatcaccttt
gaaagtttcaaagagaacctgaaggactttctgcttgtcatcccctttgactgctgggag
ccagtccaggagtga

KEGG   Homo sapiens (human): 1489
Entry
1489              CDS       T01001                                 
Symbol
CTF1, CT-1, CT1
Name
(RefSeq) cardiotrophin 1
  KO
K05422  cardiotrophin 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    1489 (CTF1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    1489 (CTF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    1489 (CTF1)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  CSF and other factors
   1489 (CTF1)
SSDB
Motif
Pfam: LIF_OSM pPIWI_RE_X NolB PRF
Other DBs
NCBI-GeneID: 1489
NCBI-ProteinID: NP_001321
OMIM: 600435
HGNC: 2499
Ensembl: ENSG00000150281
Pharos: Q16619(Tbio)
UniProt: Q16619
LinkDB
Position
16:30895846..30903560
AA seq 201 aa
MSRREGSLEDPQTDSSVSLLPHLEAKIRQTHSLAHLLTKYAEQLLQEYVQLQGDPFGLPS
FSPPRLPVAGLSAPAPSHAGLPVHERLRLDAAALAALPPLLDAVCRRQAELNPRAPRLLR
RLEDAARQARALGAAVEALLAALGAANRGPRAEPPAATASAASATGVFPAKVLGLRVCGL
YREWLSRTEGDLGQLLPGGSA
NT seq 606 nt   +upstreamnt  +downstreamnt
atgagccggagggagggaagtctggaagacccccagactgattcctcagtctcacttctt
ccccacttggaggccaagatccgtcagacacacagccttgcgcacctcctcaccaaatac
gctgagcagctgctccaggaatatgtgcagctccagggagaccccttcgggctgcccagc
ttctcgccgccgcggctgccggtggccggcctgagcgccccggctccgagccacgcgggg
ctgccagtgcacgagcggctgcggctggacgcggcggcgctggccgcgctgcccccgctg
ctggacgcagtgtgtcgccgccaggccgagctgaacccgcgcgcgccgcgcctgctgcgc
cgcctggaggacgcggcgcgccaggcccgggccctgggcgccgccgtggaggccttgctg
gccgcgctgggcgccgccaaccgcgggccccgggccgagccccccgccgccaccgcctca
gccgcctccgccaccggggtcttccccgccaaggtgctggggctccgcgtttgcggcctc
taccgcgagtggctgagccgcaccgagggcgacctgggccagctgctgcccgggggctcg
gcctga

KEGG   Homo sapiens (human): 282616
Entry
282616            CDS       T01001                                 
Symbol
IFNL2, IFNL2a, IFNL3a, IL-28A, IL28A
Name
(RefSeq) interferon lambda 2
  KO
K22669  interferon lambda 2/3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    282616 (IFNL2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    282616 (IFNL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    282616 (IFNL2)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Interferons
   282616 (IFNL2)
SSDB
Motif
Pfam: IL28A
Other DBs
NCBI-GeneID: 282616
NCBI-ProteinID: NP_742150
OMIM: 607401
HGNC: 18364
Ensembl: ENSG00000183709
Pharos: Q8IZJ0(Tbio)
UniProt: Q8IZJ0
LinkDB
Position
19:39268396..39270188
AA seq 200 aa
MKLDMTGDCTPVLVLMAAVLTVTGAVPVARLHGALPDARGCHIAQFKSLSPQELQAFKRA
KDALEESLLLKDCRCHSRLFPRTWDLRQLQVRERPMALEAELALTLKVLEATADTDPALV
DVLDQPLHTLHHILSQFRACIQPQPTAGPRTRGRLHHWLYRLQEAPKKESPGCLEASVTF
NLFRLLTRDLNCVASGDLCV
NT seq 603 nt   +upstreamnt  +downstreamnt
atgaaactagacatgactggggactgcacgccagtgctggtgctgatggccgcagtgctg
accgtgactggagcagttcctgtcgccaggctccacggggctctcccggatgcaaggggc
tgccacatagcccagttcaagtccctgtctccacaggagctgcaggcctttaagagggcc
aaagatgccttagaagagtcgcttctgctgaaggactgcaggtgccactcccgcctcttc
cccaggacctgggacctgaggcagctgcaggtgagggagcgccccatggctttggaggct
gagctggccctgacgctgaaggttctggaggccaccgctgacactgacccagccctggtg
gacgtcttggaccagccccttcacaccctgcaccatatcctctcccagttccgggcctgt
atccagcctcagcccacggcagggcccaggacccggggccgcctccaccattggctgtac
cggctccaggaggccccaaaaaaggagtcccctggctgcctcgaggcctctgtcaccttc
aacctcttccgcctcctcacgcgagacctgaattgtgttgccagtggggacctgtgtgtc
tga

KEGG   Homo sapiens (human): 282617
Entry
282617            CDS       T01001                                 
Symbol
IFNL3, IFN-lambda-3, IFN-lambda-4, IL-28B, IL-28C, IL28B, IL28C
Name
(RefSeq) interferon lambda 3
  KO
K22669  interferon lambda 2/3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    282617 (IFNL3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    282617 (IFNL3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    282617 (IFNL3)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Interferons
   282617 (IFNL3)
SSDB
Motif
Pfam: IL28A
Other DBs
NCBI-GeneID: 282617
NCBI-ProteinID: NP_742151
OMIM: 607402
HGNC: 18365
Ensembl: ENSG00000197110
Pharos: Q8IZI9(Tbio)
UniProt: Q8IZI9 A0A7R8C2Z6
Structure
LinkDB
Position
19:complement(39243455..39245250)
AA seq 196 aa
MTGDCMPVLVLMAAVLTVTGAVPVARLRGALPDARGCHIAQFKSLSPQELQAFKRAKDAL
EESLLLKDCKCRSRLFPRTWDLRQLQVRERPVALEAELALTLKVLEATADTDPALGDVLD
QPLHTLHHILSQLRACIQPQPTAGPRTRGRLHHWLHRLQEAPKKESPGCLEASVTFNLFR
LLTRDLNCVASGDLCV
NT seq 591 nt   +upstreamnt  +downstreamnt
atgaccggggactgcatgccagtgctggtgctgatggccgcagtgctgaccgtgactgga
gcagttcctgtcgccaggctccgcggggctctcccggatgcaaggggctgccacatagcc
cagttcaagtccctgtctccacaggagctgcaggcctttaagagggccaaagatgcctta
gaagagtcgcttctgctgaaggactgcaagtgccgctcccgcctcttccccaggacctgg
gacctgaggcagctgcaggtgagggagcgccccgtggctttggaggctgagctggccctg
acgctgaaggttctggaggccaccgctgacactgacccagccctgggggatgtcttggac
cagccccttcacaccctgcaccatatcctctcccagctccgggcctgtatccagcctcag
cccacggcagggcccaggacccggggccgcctccaccattggctgcaccggctccaggag
gccccaaaaaaggagtcccctggctgcctcgaggcctctgtcaccttcaacctcttccgc
ctcctcacgcgagacctgaattgtgttgccagcggggacctgtgtgtctga

KEGG   Homo sapiens (human): 282618
Entry
282618            CDS       T01001                                 
Symbol
IFNL1, IL-29, IL29
Name
(RefSeq) interferon lambda 1
  KO
K05447  interferon lambda 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    282618 (IFNL1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    282618 (IFNL1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    282618 (IFNL1)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Interferons
   282618 (IFNL1)
SSDB
Motif
Pfam: IL28A
Other DBs
NCBI-GeneID: 282618
NCBI-ProteinID: NP_742152
OMIM: 607403
HGNC: 18363
Ensembl: ENSG00000182393
Pharos: Q8IU54(Tbio)
UniProt: Q8IU54 A0A7R8C391
Structure
LinkDB
Position
19:39296407..39298673
AA seq 200 aa
MAAAWTVVLVTLVLGLAVAGPVPTSKPTTTGKGCHIGRFKSLSPQELASFKKARDALEES
LKLKNWSCSSPVFPGNWDLRLLQVRERPVALEAELALTLKVLEAAAGPALEDVLDQPLHT
LHHILSQLQACIQPQPTAGPRPRGRLHHWLHRLQEAPKKESAGCLEASVTFNLFRLLTRD
LKYVADGNLCLRTSTHPEST
NT seq 603 nt   +upstreamnt  +downstreamnt
atggctgcagcttggaccgtggtgctggtgactttggtgctaggcttggccgtggcaggc
cctgtccccacttccaagcccaccacaactgggaagggctgccacattggcaggttcaaa
tctctgtcaccacaggagctagcgagcttcaagaaggccagggacgccttggaagagtca
ctcaagctgaaaaactggagttgcagctctcctgtcttccccgggaattgggacctgagg
cttctccaggtgagggagcgccctgtggccttggaggctgagctggccctgacgctgaag
gtcctggaggccgctgctggcccagccctggaggacgtcctagaccagccccttcacacc
ctgcaccacatcctctcccagctccaggcctgtatccagcctcagcccacagcagggccc
aggccccggggccgcctccaccactggctgcaccggctccaggaggcccccaaaaaggag
tccgctggctgcctggaggcatctgtcaccttcaacctcttccgcctcctcacgcgagac
ctcaaatatgtggccgatgggaacctgtgtctgagaacgtcaacccaccctgagtccacc
tga

KEGG   Homo sapiens (human): 29949
Entry
29949             CDS       T01001                                 
Symbol
IL19, IL-10C, MDA1, NG.1, ZMDA1
Name
(RefSeq) interleukin 19
  KO
K05444  interleukin 19
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04630  JAK-STAT signaling pathway
Network
nt06150  Cytokine-cytokine receptor interaction (viruses)
  Element
N01271  IL19/20/24 to IL20R signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    29949 (IL19)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    29949 (IL19)
   04061 Viral protein interaction with cytokine and cytokine receptor
    29949 (IL19)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    29949 (IL19)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Interleukins
   29949 (IL19)
SSDB
Motif
Pfam: IL10 MIF4G
Other DBs
NCBI-GeneID: 29949
NCBI-ProteinID: NP_037503
OMIM: 605687
HGNC: 5990
Ensembl: ENSG00000142224
Pharos: Q9UHD0(Tbio)
UniProt: Q9UHD0
Structure
LinkDB
Position
1:206770773..206842981
AA seq 177 aa
MKLQCVSLWLLGTILILCSVDNHGLRRCLISTDMHHIEESFQEIKRAIQAKDTFPNVTIL
STLETLQIIKPLDVCCVTKNLLAFYVDRVFKDHQEPNPKILRKISSIANSFLYMQKTLRQ
CQEQRQCHCRQEATNATRVIHDNYDQLEVHAAAIKSLGELDVFLAWINKNHEVMFSA
NT seq 534 nt   +upstreamnt  +downstreamnt
atgaagttacagtgtgtttccctttggctcctgggtacaatactgatattgtgctcagta
gacaaccacggtctcaggagatgtctgatttccacagacatgcaccatatagaagagagt
ttccaagaaatcaaaagagccatccaagctaaggacaccttcccaaatgtcactatcctg
tccacattggagactctgcagatcattaagcccttagatgtgtgctgcgtgaccaagaac
ctcctggcgttctacgtggacagggtgttcaaggatcatcaggagccaaaccccaaaatc
ttgagaaaaatcagcagcattgccaactctttcctctacatgcagaaaactctgcggcaa
tgtcaggaacagaggcagtgtcactgcaggcaggaagccaccaatgccaccagagtcatc
catgacaactatgatcagctggaggtccacgctgctgccattaaatccctgggagagctc
gacgtctttctagcctggattaataagaatcatgaagtaatgttctcagcttga

KEGG   Homo sapiens (human): 338376
Entry
338376            CDS       T01001                                 
Symbol
IFNE, IFN-E, IFNE1, IFNT1, INFE1, PRO655
Name
(RefSeq) interferon epsilon
  KO
K05442  interferon epsilon
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04622  RIG-I-like receptor signaling pathway
hsa04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    338376 (IFNE)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    338376 (IFNE)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    338376 (IFNE)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    338376 (IFNE)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Interferons
   338376 (IFNE)
SSDB
Motif
Pfam: Interferon YutD-like
Other DBs
NCBI-GeneID: 338376
NCBI-ProteinID: NP_795372
OMIM: 615223
HGNC: 18163
Ensembl: ENSG00000184995
Pharos: Q86WN2(Tbio)
UniProt: Q86WN2 A0A7R8GUQ9
LinkDB
Position
9:complement(21480839..21482313)
AA seq 208 aa
MIIKHFFGTVLVLLASTTIFSLDLKLIIFQQRQVNQESLKLLNKLQTLSIQQCLPHRKNF
LLPQKSLSPQQYQKGHTLAILHEMLQQIFSLFRANISLDGWEENHTEKFLIQLHQQLEYL
EALMGLEAEKLSGTLGSDNLRLQVKMYFRRIHDYLENQDYSTCAWAIVQVEISRCLFFVF
SLTEKLSKQGRPLNDMKQELTTEFRSPR
NT seq 627 nt   +upstreamnt  +downstreamnt
atgattatcaagcacttctttggaactgtgttggtgctgctggcctctaccactatcttc
tctctagatttgaaactgattatcttccagcaaagacaagtgaatcaagaaagtttaaaa
ctcttgaataagttgcaaaccttgtcaattcagcagtgtctaccacacaggaaaaacttt
ctgcttcctcagaagtctttgagtcctcagcagtaccaaaaaggacacactctggccatt
ctccatgagatgcttcagcagatcttcagcctcttcagggcaaatatttctctggatggt
tgggaggaaaaccacacggagaaattcctcattcaacttcatcaacagctagaataccta
gaagcactcatgggactggaagcagagaagctaagtggtactttgggtagtgataacctt
agattacaagttaaaatgtacttccgaaggatccatgattacctggaaaaccaggactac
agcacctgtgcctgggccattgtccaagtagaaatcagccgatgtctgttctttgtgttc
agtctcacagaaaaactgagcaaacaaggaagacccttgaacgacatgaagcaagagctt
actacagagtttagaagcccgaggtag

KEGG   Homo sapiens (human): 3439
Entry
3439              CDS       T01001                                 
Symbol
IFNA1, IFL, IFN, IFN-ALPHA, IFN-alphaD, IFNA13, IFNA@, leIF_D
Name
(RefSeq) interferon alpha 1
  KO
K05414  interferon alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04217  Necroptosis
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04623  Cytosolic DNA-sensing pathway
hsa04630  JAK-STAT signaling pathway
hsa04650  Natural killer cell mediated cytotoxicity
hsa04936  Alcoholic liver disease
hsa05152  Tuberculosis
hsa05160  Hepatitis C
hsa05161  Hepatitis B
hsa05162  Measles
hsa05163  Human cytomegalovirus infection
hsa05164  Influenza A
hsa05165  Human papillomavirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05171  Coronavirus disease - COVID-19
hsa05200  Pathways in cancer
hsa05320  Autoimmune thyroid disease
hsa05417  Lipid and atherosclerosis
Network
nt06119  JAK-STAT signaling (viruses)
nt06121  TLR signaling (viruses and bacteria)
nt06122  IFN signaling (viruses)
nt06133  RLR signaling (viruses)
nt06134  CGAS-STING signaling (viruses and bacteria)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06163  Hepatitis C virus (HCV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06170  Influenza A virus (IAV)
nt06171  Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
nt06219  JAK-STAT signaling
nt06221  TLR signaling
nt06222  IFN signaling
nt06263  Hepatocellular carcinoma
nt06266  Non-small cell lung cancer
nt06276  Chronic myeloid leukemia
  Element
N00053  Cytokine-Jak-STAT signaling pathway
N00148  TLR3-IRF7 signaling pathway
N00150  Type I IFN signaling pathway
N00395  cGAS-STING signaling pathway
N00436  HIV Tat to TLR2/4-NFKB signaling pathway
N00469  RIG-I-IRF7/3 signaling pathway
N00688  RIG-I-NFKB signaling pathway
N00690  TLR7/9-IRF7 signaling pathway
N01308  MDA5-IRF7/3 signaling pathway
Drug target
Rontalizumab: D09662
Sifalimumab: D09668
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    3439 (IFNA1)
   04151 PI3K-Akt signaling pathway
    3439 (IFNA1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3439 (IFNA1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    3439 (IFNA1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    3439 (IFNA1)
   04621 NOD-like receptor signaling pathway
    3439 (IFNA1)
   04622 RIG-I-like receptor signaling pathway
    3439 (IFNA1)
   04623 Cytosolic DNA-sensing pathway
    3439 (IFNA1)
   04650 Natural killer cell mediated cytotoxicity
    3439 (IFNA1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3439 (IFNA1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    3439 (IFNA1)
   05161 Hepatitis B
    3439 (IFNA1)
   05160 Hepatitis C
    3439 (IFNA1)
   05171 Coronavirus disease - COVID-19
    3439 (IFNA1)
   05164 Influenza A
    3439 (IFNA1)
   05162 Measles
    3439 (IFNA1)
   05168 Herpes simplex virus 1 infection
    3439 (IFNA1)
   05163 Human cytomegalovirus infection
    3439 (IFNA1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    3439 (IFNA1)
   05169 Epstein-Barr virus infection
    3439 (IFNA1)
   05165 Human papillomavirus infection
    3439 (IFNA1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    3439 (IFNA1)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    3439 (IFNA1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    3439 (IFNA1)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    3439 (IFNA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    3439 (IFNA1)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Interferons
   3439 (IFNA1)
SSDB
Motif
Pfam: Interferon iSTAND CBF
Other DBs
NCBI-GeneID: 3439
NCBI-ProteinID: NP_076918
OMIM: 147660
HGNC: 5417
Ensembl: ENSG00000197919
Pharos: P01562(Tbio)
UniProt: P01562 L0N195
Structure
LinkDB
Position
9:21440439..21441316
AA seq 189 aa
MASPFALLMVLVVLSCKSSCSLGCDLPETHSLDNRRTLMLLAQMSRISPSSCLMDRHDFG
FPQEEFDGNQFQKAPAISVLHELIQQIFNLFTTKDSSAAWDEDLLDKFCTELYQQLNDLE
ACVMQEERVGETPLMNADSILAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSLSLSTN
LQERLRRKE
NT seq 570 nt   +upstreamnt  +downstreamnt
atggcctcgccctttgctttactgatggtcctggtggtgctcagctgcaagtcaagctgc
tctctgggctgtgatctccctgagacccacagcctggataacaggaggaccttgatgctc
ctggcacaaatgagcagaatctctccttcctcctgtctgatggacagacatgactttgga
tttccccaggaggagtttgatggcaaccagttccagaaggctccagccatctctgtcctc
catgagctgatccagcagatcttcaacctctttaccacaaaagattcatctgctgcttgg
gatgaggacctcctagacaaattctgcaccgaactctaccagcagctgaatgacttggaa
gcctgtgtgatgcaggaggagagggtgggagaaactcccctgatgaatgcggactccatc
ttggctgtgaagaaatacttccgaagaatcactctctatctgacagagaagaaatacagc
ccttgtgcctgggaggttgtcagagcagaaatcatgagatccctctctttatcaacaaac
ttgcaagaaagattaaggaggaaggaataa

KEGG   Homo sapiens (human): 3440
Entry
3440              CDS       T01001                                 
Symbol
IFNA2, IFN-alpha-2, IFN-alphaA, IFNA, IFNA2B, leIF_A
Name
(RefSeq) interferon alpha 2
  KO
K05414  interferon alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04217  Necroptosis
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04623  Cytosolic DNA-sensing pathway
hsa04630  JAK-STAT signaling pathway
hsa04650  Natural killer cell mediated cytotoxicity
hsa04936  Alcoholic liver disease
hsa05152  Tuberculosis
hsa05160  Hepatitis C
hsa05161  Hepatitis B
hsa05162  Measles
hsa05163  Human cytomegalovirus infection
hsa05164  Influenza A
hsa05165  Human papillomavirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05171  Coronavirus disease - COVID-19
hsa05200  Pathways in cancer
hsa05320  Autoimmune thyroid disease
hsa05417  Lipid and atherosclerosis
Network
nt06121  TLR signaling (viruses and bacteria)
nt06122  IFN signaling (viruses)
nt06133  RLR signaling (viruses)
nt06134  CGAS-STING signaling (viruses and bacteria)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06163  Hepatitis C virus (HCV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06170  Influenza A virus (IAV)
nt06171  Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
nt06221  TLR signaling
nt06222  IFN signaling
nt06263  Hepatocellular carcinoma
  Element
N00148  TLR3-IRF7 signaling pathway
N00150  Type I IFN signaling pathway
N00395  cGAS-STING signaling pathway
N00436  HIV Tat to TLR2/4-NFKB signaling pathway
N00469  RIG-I-IRF7/3 signaling pathway
N00688  RIG-I-NFKB signaling pathway
N00690  TLR7/9-IRF7 signaling pathway
N01308  MDA5-IRF7/3 signaling pathway
Drug target
Rontalizumab: D09662
Sifalimumab: D09668
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    3440 (IFNA2)
   04151 PI3K-Akt signaling pathway
    3440 (IFNA2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3440 (IFNA2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    3440 (IFNA2)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    3440 (IFNA2)
   04621 NOD-like receptor signaling pathway
    3440 (IFNA2)
   04622 RIG-I-like receptor signaling pathway
    3440 (IFNA2)
   04623 Cytosolic DNA-sensing pathway
    3440 (IFNA2)
   04650 Natural killer cell mediated cytotoxicity
    3440 (IFNA2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3440 (IFNA2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    3440 (IFNA2)
   05161 Hepatitis B
    3440 (IFNA2)
   05160 Hepatitis C
    3440 (IFNA2)
   05171 Coronavirus disease - COVID-19
    3440 (IFNA2)
   05164 Influenza A
    3440 (IFNA2)
   05162 Measles
    3440 (IFNA2)
   05168 Herpes simplex virus 1 infection
    3440 (IFNA2)
   05163 Human cytomegalovirus infection
    3440 (IFNA2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    3440 (IFNA2)
   05169 Epstein-Barr virus infection
    3440 (IFNA2)
   05165 Human papillomavirus infection
    3440 (IFNA2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    3440 (IFNA2)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    3440 (IFNA2)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    3440 (IFNA2)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    3440 (IFNA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    3440 (IFNA2)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Interferons
   3440 (IFNA2)
SSDB
Motif
Pfam: Interferon CBF iSTAND APC1_C DDHD ORF6C
Other DBs
NCBI-GeneID: 3440
NCBI-ProteinID: NP_000596
OMIM: 147562
HGNC: 5423
Ensembl: ENSG00000188379
Pharos: P01563(Tbio)
UniProt: P01563 A0A7R8GUN5
Structure
LinkDB
Position
9:complement(21384255..21385398)
AA seq 188 aa
MALTFALLVALLVLSCKSSCSVGCDLPQTHSLGSRRTLMLLAQMRRISLFSCLKDRHDFG
FPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEA
CVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNL
QESLRSKE
NT seq 567 nt   +upstreamnt  +downstreamnt
atggccttgacctttgctttactggtggccctcctggtgctcagctgcaagtcaagctgc
tctgtgggctgtgatctgcctcaaacccacagcctgggtagcaggaggaccttgatgctc
ctggcacagatgaggagaatctctcttttctcctgcttgaaggacagacatgactttgga
tttccccaggaggagtttggcaaccagttccaaaaggctgaaaccatccctgtcctccat
gagatgatccagcagatcttcaatctcttcagcacaaaggactcatctgctgcttgggat
gagaccctcctagacaaattctacactgaactctaccagcagctgaatgacctggaagcc
tgtgtgatacagggggtgggggtgacagagactcccctgatgaaggaggactccattctg
gctgtgaggaaatacttccaaagaatcactctctatctgaaagagaagaaatacagccct
tgtgcctgggaggttgtcagagcagaaatcatgagatctttttctttgtcaacaaacttg
caagaaagtttaagaagtaaggaatga

DBGET integrated database retrieval system