KEGG   Homo sapiens (human): 11009
Entry
11009             CDS       T01001                                 
Symbol
IL24, C49A, FISP, IL10B, MDA7, MOB5, ST16
Name
(RefSeq) interleukin 24
  KO
K22668  interleukin 24
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04630  JAK-STAT signaling pathway
Network
nt06167  Human cytomegalovirus (HCMV)
nt06518  JAK-STAT signaling
  Element
N00415  IL10 family to Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    11009 (IL24)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    11009 (IL24)
   04061 Viral protein interaction with cytokine and cytokine receptor
    11009 (IL24)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and neuropeptides [BR:hsa04052]
    11009 (IL24)
Cytokines and neuropeptides [BR:hsa04052]
 Cytokines
  Interleukins
   11009 (IL24)
SSDB
Motif
Pfam: IL22 IL10
Other DBs
NCBI-GeneID: 11009
NCBI-ProteinID: NP_006841
OMIM: 604136
HGNC: 11346
Ensembl: ENSG00000162892
UniProt: Q13007
Structure
LinkDB
Position
1:206897443..206904139
AA seq 206 aa
MNFQQRLQSLWTLARPFCPPLLATASQMQMVVLPCLGFTLLLWSQVSGAQGQEFHFGPCQ
VKGVVPQKLWEAFWAVKDTMQAQDNITSARLLQQEVLQNVSDAESCYLVHTLLEFYLKTV
FKNYHNRTVEVRTLKSFSTLANNFVLIVSQLQPSQENEMFSIRDSAHRRFLLFRRAFKQL
DVEAALTKALGEVDILLTWMQKFYKL
NT seq 621 nt   +upstreamnt  +downstreamnt
atgaattttcaacagaggctgcaaagcctgtggactttagccagacccttctgccctcct
ttgctggcgacagcctctcaaatgcagatggttgtgctcccttgcctgggttttaccctg
cttctctggagccaggtatcaggggcccagggccaagaattccactttgggccctgccaa
gtgaagggggttgttccccagaaactgtgggaagccttctgggctgtgaaagacactatg
caagctcaggataacatcacgagtgcccggctgctgcagcaggaggttctgcagaacgtc
tcggatgctgagagctgttaccttgtccacaccctgctggagttctacttgaaaactgtt
ttcaaaaactaccacaatagaacagttgaagtcaggactctgaagtcattctctactctg
gccaacaactttgttctcatcgtgtcacaactgcaacccagtcaagaaaatgagatgttt
tccatcagagacagtgcacacaggcggtttctgctattccggagagcattcaaacagttg
gacgtagaagcagctctgaccaaagcccttggggaagtggacattcttctgacctggatg
cagaaattctacaagctctga

KEGG   Homo sapiens (human): 29949
Entry
29949             CDS       T01001                                 
Symbol
IL19, IL-10C, MDA1, NG.1, ZMDA1
Name
(RefSeq) interleukin 19
  KO
K05444  interleukin 19
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04630  JAK-STAT signaling pathway
Network
nt06167  Human cytomegalovirus (HCMV)
nt06518  JAK-STAT signaling
  Element
N00415  IL10 family to Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    29949 (IL19)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    29949 (IL19)
   04061 Viral protein interaction with cytokine and cytokine receptor
    29949 (IL19)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and neuropeptides [BR:hsa04052]
    29949 (IL19)
Cytokines and neuropeptides [BR:hsa04052]
 Cytokines
  Interleukins
   29949 (IL19)
SSDB
Motif
Pfam: IL10 MitMem_reg Cas5fv_helical
Other DBs
NCBI-GeneID: 29949
NCBI-ProteinID: NP_037503
OMIM: 605687
HGNC: 5990
Ensembl: ENSG00000142224
UniProt: Q9UHD0
Structure
LinkDB
Position
1:206770773..206842981
AA seq 177 aa
MKLQCVSLWLLGTILILCSVDNHGLRRCLISTDMHHIEESFQEIKRAIQAKDTFPNVTIL
STLETLQIIKPLDVCCVTKNLLAFYVDRVFKDHQEPNPKILRKISSIANSFLYMQKTLRQ
CQEQRQCHCRQEATNATRVIHDNYDQLEVHAAAIKSLGELDVFLAWINKNHEVMFSA
NT seq 534 nt   +upstreamnt  +downstreamnt
atgaagttacagtgtgtttccctttggctcctgggtacaatactgatattgtgctcagta
gacaaccacggtctcaggagatgtctgatttccacagacatgcaccatatagaagagagt
ttccaagaaatcaaaagagccatccaagctaaggacaccttcccaaatgtcactatcctg
tccacattggagactctgcagatcattaagcccttagatgtgtgctgcgtgaccaagaac
ctcctggcgttctacgtggacagggtgttcaaggatcatcaggagccaaaccccaaaatc
ttgagaaaaatcagcagcattgccaactctttcctctacatgcagaaaactctgcggcaa
tgtcaggaacagaggcagtgtcactgcaggcaggaagccaccaatgccaccagagtcatc
catgacaactatgatcagctggaggtccacgctgctgccattaaatccctgggagagctc
gacgtctttctagcctggattaataagaatcatgaagtaatgttctcagcttga

KEGG   Homo sapiens (human): 3586
Entry
3586              CDS       T01001                                 
Symbol
IL10, CSIF, GVHDS, IL-10, IL10A, TGIF
Name
(RefSeq) interleukin 10
  KO
K05443  interleukin 10
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04068  FoxO signaling pathway
hsa04148  Efferocytosis
hsa04625  C-type lectin receptor signaling pathway
hsa04630  JAK-STAT signaling pathway
hsa04660  T cell receptor signaling pathway
hsa04672  Intestinal immune network for IgA production
hsa05133  Pertussis
hsa05135  Yersinia infection
hsa05140  Leishmaniasis
hsa05142  Chagas disease
hsa05143  African trypanosomiasis
hsa05144  Malaria
hsa05145  Toxoplasmosis
hsa05146  Amoebiasis
hsa05150  Staphylococcus aureus infection
hsa05152  Tuberculosis
hsa05310  Asthma
hsa05320  Autoimmune thyroid disease
hsa05321  Inflammatory bowel disease
hsa05322  Systemic lupus erythematosus
hsa05330  Allograft rejection
Network
nt06167  Human cytomegalovirus (HCMV)
nt06518  JAK-STAT signaling
nt06535  Efferocytosis
  Element
N00415  IL10 family to Jak-STAT signaling pathway
N01778  Production of IL10 via the Sirtuin1 signaling cascade
Disease
H00083  Allograft rejection
H00084  Graft-versus-host disease
H00630  Rheumatoid arthritis
H01227  Inflammatory bowel disease (IBD)
H01466  Ulcerative colitis
H01563  HIV infection
Drug target
Pirfenidone: D01583<JP/US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    3586 (IL10)
   04068 FoxO signaling pathway
    3586 (IL10)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3586 (IL10)
   04061 Viral protein interaction with cytokine and cytokine receptor
    3586 (IL10)
 09140 Cellular Processes
  09141 Transport and catabolism
   04148 Efferocytosis
    3586 (IL10)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    3586 (IL10)
   04660 T cell receptor signaling pathway
    3586 (IL10)
   04672 Intestinal immune network for IgA production
    3586 (IL10)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    3586 (IL10)
   05133 Pertussis
    3586 (IL10)
   05150 Staphylococcus aureus infection
    3586 (IL10)
   05152 Tuberculosis
    3586 (IL10)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    3586 (IL10)
   05144 Malaria
    3586 (IL10)
   05145 Toxoplasmosis
    3586 (IL10)
   05140 Leishmaniasis
    3586 (IL10)
   05142 Chagas disease
    3586 (IL10)
   05143 African trypanosomiasis
    3586 (IL10)
  09163 Immune disease
   05310 Asthma
    3586 (IL10)
   05322 Systemic lupus erythematosus
    3586 (IL10)
   05320 Autoimmune thyroid disease
    3586 (IL10)
   05321 Inflammatory bowel disease
    3586 (IL10)
   05330 Allograft rejection
    3586 (IL10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and neuropeptides [BR:hsa04052]
    3586 (IL10)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    3586 (IL10)
Cytokines and neuropeptides [BR:hsa04052]
 Cytokines
  Interleukins
   3586 (IL10)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Heparin
  Cytokines
   3586 (IL10)
SSDB
Motif
Pfam: IL10 IL22 ALIX_LYPXL_bnd CLZ
Other DBs
NCBI-GeneID: 3586
NCBI-ProteinID: NP_000563
OMIM: 124092
HGNC: 5962
Ensembl: ENSG00000136634
UniProt: P22301 Q6FGW4
Structure
LinkDB
Position
1:complement(206767602..206772494)
AA seq 178 aa
MHSSALLCCLVLLTGVRASPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQ
LDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLR
LRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN
NT seq 537 nt   +upstreamnt  +downstreamnt
atgcacagctcagcactgctctgttgcctggtcctcctgactggggtgagggccagccca
ggccagggcacccagtctgagaacagctgcacccacttcccaggcaacctgcctaacatg
cttcgagatctccgagatgccttcagcagagtgaagactttctttcaaatgaaggatcag
ctggacaacttgttgttaaaggagtccttgctggaggactttaagggttacctgggttgc
caagccttgtctgagatgatccagttttacctggaggaggtgatgccccaagctgagaac
caagacccagacatcaaggcgcatgtgaactccctgggggagaacctgaagaccctcagg
ctgaggctacggcgctgtcatcgatttcttccctgtgaaaacaagagcaaggccgtggag
caggtgaagaatgcctttaataagctccaagagaaaggcatctacaaagccatgagtgag
tttgacatcttcatcaactacatagaagcctacatgacaatgaagatacgaaactga

KEGG   Homo sapiens (human): 50604
Entry
50604             CDS       T01001                                 
Symbol
IL20, IL-20, IL10D, ZCYTO10
Name
(RefSeq) interleukin 20
  KO
K22667  interleukin 20
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04630  JAK-STAT signaling pathway
Network
nt06167  Human cytomegalovirus (HCMV)
nt06518  JAK-STAT signaling
  Element
N00415  IL10 family to Jak-STAT signaling pathway
Drug target
Fletikumab: D11756
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    50604 (IL20)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    50604 (IL20)
   04061 Viral protein interaction with cytokine and cytokine receptor
    50604 (IL20)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and neuropeptides [BR:hsa04052]
    50604 (IL20)
Cytokines and neuropeptides [BR:hsa04052]
 Cytokines
  Interleukins
   50604 (IL20)
SSDB
Motif
Pfam: IL10 PP_kinase
Other DBs
NCBI-GeneID: 50604
NCBI-ProteinID: NP_061194
OMIM: 605619
HGNC: 6002
Ensembl: ENSG00000162891
UniProt: Q9NYY1 A0A7R8C4W0
Structure
LinkDB
Position
1:206863565..206869223
AA seq 176 aa
MKASSLAFSLLSAAFYLLWTPSTGLKTLNLGSCVIATNLQEIRNGFSEIRGSVQAKDGNI
DIRILRRTESLQDTKPANRCCLLRHLLRLYLDRVFKNYQTPDHYTLRKISSLANSFLTIK
KDLRLCHAHMTCHCGEEAMKKYSQILSHFEKLEPQAAVVKALGELDILLQWMEETE
NT seq 531 nt   +upstreamnt  +downstreamnt
atgaaagcctctagtcttgccttcagccttctctctgctgcgttttatctcctatggact
ccttccactggactgaagacactcaatttgggaagctgtgtgatcgccacaaaccttcag
gaaatacgaaatggattttctgagatacggggcagtgtgcaagccaaagatggaaacatt
gacatcagaatcttaaggaggactgagtctttgcaagacacaaagcctgcgaatcgatgc
tgcctcctgcgccatttgctaagactctatctggacagggtatttaaaaactaccagacc
cctgaccattatactctccggaagatcagcagcctcgccaattcctttcttaccatcaag
aaggacctccggctctgtcatgcccacatgacatgccattgtggggaggaagcaatgaag
aaatacagccagattctgagtcactttgaaaagctggaacctcaggcagcagttgtgaag
gctttgggggaactagacattcttctgcaatggatggaggagacagaatag

KEGG   Homo sapiens (human): 50616
Entry
50616             CDS       T01001                                 
Symbol
IL22, IL-21, IL-22, IL-D110, IL-TIF, ILTIF, TIFIL-23, TIFa, zcyto18
Name
(RefSeq) interleukin 22
  KO
K05445  interleukin 22
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04630  JAK-STAT signaling pathway
hsa04659  Th17 cell differentiation
hsa05321  Inflammatory bowel disease
Network
nt06167  Human cytomegalovirus (HCMV)
nt06227  Nuclear receptor signaling (cancer)
nt06360  Cushing syndrome
nt06518  JAK-STAT signaling
  Element
N00317  AhR signaling pathway
N00415  IL10 family to Jak-STAT signaling pathway
Drug target
Efmarodocokin alfa: D11953
Fezakinumab: D09615
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    50616 (IL22)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    50616 (IL22)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    50616 (IL22)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease
    50616 (IL22)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and neuropeptides [BR:hsa04052]
    50616 (IL22)
Cytokines and neuropeptides [BR:hsa04052]
 Cytokines
  Interleukins
   50616 (IL22)
SSDB
Motif
Pfam: IL22 IL10 IL28A
Other DBs
NCBI-GeneID: 50616
NCBI-ProteinID: NP_065386
OMIM: 605330
HGNC: 14900
Ensembl: ENSG00000127318
UniProt: Q9GZX6 A0A7R8C389
Structure
LinkDB
Position
12:complement(68248242..68253604)
AA seq 179 aa
MAALQKSVSSFLMGTLATSCLLLLALLVQGGAAAPISSHCRLDKSNFQQPYITNRTFMLA
KEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVP
FLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI
NT seq 540 nt   +upstreamnt  +downstreamnt
atggccgccctgcagaaatctgtgagctctttccttatggggaccctggccaccagctgc
ctccttctcttggccctcttggtacagggaggagcagctgcgcccatcagctcccactgc
aggcttgacaagtccaacttccagcagccctatatcaccaaccgcaccttcatgctggct
aaggaggctagcttggctgataacaacacagacgttcgtctcattggggagaaactgttc
cacggagtcagtatgagtgagcgctgctatctgatgaagcaggtgctgaacttcaccctt
gaagaagtgctgttccctcaatctgataggttccagccttatatgcaggaggtggtgccc
ttcctggccaggctcagcaacaggctaagcacatgtcatattgaaggtgatgacctgcat
atccagaggaatgtgcaaaagctgaaggacacagtgaaaaagcttggagagagtggagag
atcaaagcaattggagaactggatttgctgtttatgtctctgagaaatgcctgcatttga

KEGG   Homo sapiens (human): 55801
Entry
55801             CDS       T01001                                 
Symbol
IL26, AK155, IL-26
Name
(RefSeq) interleukin 26
  KO
K05446  interleukin 26
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04630  JAK-STAT signaling pathway
Network
nt06167  Human cytomegalovirus (HCMV)
nt06518  JAK-STAT signaling
  Element
N00415  IL10 family to Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    55801 (IL26)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    55801 (IL26)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and neuropeptides [BR:hsa04052]
    55801 (IL26)
Cytokines and neuropeptides [BR:hsa04052]
 Cytokines
  Interleukins
   55801 (IL26)
SSDB
Motif
Pfam: IL10 IL22 PRP9_N
Other DBs
NCBI-GeneID: 55801
NCBI-ProteinID: NP_060872
OMIM: 605679
HGNC: 17119
Ensembl: ENSG00000111536
UniProt: Q9NPH9 A0A7R8GUW8
LinkDB
Position
12:complement(68201349..68225810)
AA seq 171 aa
MLVNFILRCGLLLVTLSLAIAKHKQSSFTKSCYPRGTLSQAVDALYIKAAWLKATIPEDR
IKNIRLLKKKTKKQFMKNCQFQEQLLSFFMEDVFGQLQLQGCKKIRFVEDFHSLRQKLSH
CISCASSAREMKSITRMKRIFYRIGNKGIYKAISELDILLSWIKKLLESSQ
NT seq 516 nt   +upstreamnt  +downstreamnt
atgctggtgaatttcattttgaggtgtgggttgctgttagtcactctgtctcttgccatt
gccaagcacaagcaatcttccttcaccaaaagttgttacccaaggggaacattgtcccaa
gctgttgacgctctctatatcaaagcagcatggctcaaagcaacgattccagaagaccgc
ataaaaaatatacgattattaaaaaagaaaacaaaaaagcagtttatgaaaaactgtcaa
tttcaagaacagcttctgtccttcttcatggaagacgtttttggtcaactgcaattgcaa
ggctgcaagaaaatacgctttgtggaggactttcatagccttaggcagaaattgagccac
tgtatttcctgtgcttcatcagctagagagatgaaatccattaccaggatgaaaagaata
ttttataggattggaaacaaaggaatctacaaagccatcagtgaactggatattcttctt
tcctggattaaaaaattattggaaagcagtcagtaa

DBGET integrated database retrieval system