KEGG   Homo sapiens (human): 11157
Entry
11157             CDS       T01001                                 
Symbol
LSM6, YDR378C
Name
(RefSeq) LSM6 homolog, U6 small nuclear RNA and mRNA degradation associated
  KO
K12625  U6 snRNA-associated Sm-like protein LSm6
Organism
hsa  Homo sapiens (human)
Pathway
hsa03018  RNA degradation
hsa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    11157 (LSM6)
  09123 Folding, sorting and degradation
   03018 RNA degradation
    11157 (LSM6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    11157 (LSM6)
   03041 Spliceosome [BR:hsa03041]
    11157 (LSM6)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     11157 (LSM6)
  mRNA degradation factors
   5'-3' decay
    Lsm complex
     11157 (LSM6)
Spliceosome [BR:hsa03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   LSm proteins
    11157 (LSM6)
SSDB
Motif
Pfam: LSM SM-ATX LSM14
Other DBs
NCBI-GeneID: 11157
NCBI-ProteinID: NP_009011
OMIM: 607286
HGNC: 17017
Ensembl: ENSG00000164167
Pharos: P62312(Tdark)
UniProt: P62312
Structure
LinkDB
Position
4:146175718..146191535
AA seq 80 aa
MSLRKQTPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYMNIALEQTEEYVNGQLKNKY
GDAFIRGNNVLYISTQKRRM
NT seq 243 nt   +upstreamnt  +downstreamnt
atgagtcttcggaagcaaacccctagtgacttcttaaagcaaatcatcggacgaccagtt
gtggtaaaattaaattctggagtggattatcgaggggtcctggcttgcctggatggctac
atgaatatagccctggagcagacagaagaatatgtaaatggacaactgaagaataagtat
ggggatgcatttatccgaggaaacaatgtgttgtacatcagtacacagaagagacggatg
tga

KEGG   Homo sapiens (human): 23658
Entry
23658             CDS       T01001                                 
Symbol
LSM5, YER146W
Name
(RefSeq) LSM5 homolog, U6 small nuclear RNA and mRNA degradation associated
  KO
K12624  U6 snRNA-associated Sm-like protein LSm5
Organism
hsa  Homo sapiens (human)
Pathway
hsa03018  RNA degradation
hsa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    23658 (LSM5)
  09123 Folding, sorting and degradation
   03018 RNA degradation
    23658 (LSM5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    23658 (LSM5)
   03041 Spliceosome [BR:hsa03041]
    23658 (LSM5)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     23658 (LSM5)
  mRNA degradation factors
   5'-3' decay
    Lsm complex
     23658 (LSM5)
Spliceosome [BR:hsa03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   LSm proteins
    23658 (LSM5)
SSDB
Motif
Pfam: LSM SM-ATX
Other DBs
NCBI-GeneID: 23658
NCBI-ProteinID: NP_036454
OMIM: 607285
HGNC: 17162
Ensembl: ENSG00000106355
Pharos: Q9Y4Y9(Tdark)
UniProt: Q9Y4Y9 A0A090N8Y5
Structure
LinkDB
Position
7:complement(32485338..32495283)
AA seq 91 aa
MAANATTNPSQLLPLELVDKCIGSRIHIVMKSDKEIVGTLLGFDDFVNMVLEDVTEFEIT
PEGRRITKLDQILLNGNNITMLVPGGEGPEV
NT seq 276 nt   +upstreamnt  +downstreamnt
atggcggctaacgctactaccaacccgtcgcagctgctgcccttagagcttgtggacaaa
tgtataggatcaagaattcacatcgtgatgaagagtgataaggaaattgttggtactctt
ctaggatttgatgactttgtcaatatggtactggaagatgtcactgagtttgaaatcaca
ccagaaggaagaaggattactaaattagatcagattttgctaaatggaaataatataaca
atgctggttcctggaggagaaggacctgaagtgtga

KEGG   Homo sapiens (human): 25804
Entry
25804             CDS       T01001                                 
Symbol
LSM4, GRP, YER112W
Name
(RefSeq) LSM4 homolog, U6 small nuclear RNA and mRNA degradation associated
  KO
K12623  U6 snRNA-associated Sm-like protein LSm4
Organism
hsa  Homo sapiens (human)
Pathway
hsa03018  RNA degradation
hsa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    25804 (LSM4)
  09123 Folding, sorting and degradation
   03018 RNA degradation
    25804 (LSM4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    25804 (LSM4)
   03041 Spliceosome [BR:hsa03041]
    25804 (LSM4)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     25804 (LSM4)
  mRNA degradation factors
   5'-3' decay
    Lsm complex
     25804 (LSM4)
Spliceosome [BR:hsa03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   LSm proteins
    25804 (LSM4)
SSDB
Motif
Pfam: LSM
Other DBs
NCBI-GeneID: 25804
NCBI-ProteinID: NP_036453
OMIM: 607284
HGNC: 17259
Ensembl: ENSG00000130520
Pharos: Q9Y4Z0(Tbio)
UniProt: Q9Y4Z0
Structure
LinkDB
Position
19:complement(18306236..18323076)
AA seq 139 aa
MLPLSLLKTAQNHPMLVELKNGETYNGHLVSCDNWMNINLREVICTSRDGDKFWRMPECY
IRGSTIKYLRIPDEIIDMVKEEVVAKGRGRGGLQQQKQQKGRGMGGAGRGVFGGRGRGGI
PGTGRGQPEKKPGRQAGKQ
NT seq 420 nt   +upstreamnt  +downstreamnt
atgcttcccttgtcactgctgaagacggctcagaatcaccccatgttggtggagctgaaa
aatggggagacgtacaatggacacctggtgagctgcgacaactggatgaacattaacctg
cgagaagtcatctgcacgtccagggacggggacaagttctggcggatgcccgagtgctac
atccgcggcagcaccatcaagtacctgcgcatccccgacgagatcatcgacatggtcaag
gaggaggtggtggccaagggccgcggccgcggaggcctgcagcagcagaagcagcagaaa
ggccgcggcatgggcggcgctggccgaggtgtgtttggtggccggggccgaggtgggatc
ccgggcacaggcagaggccagccagagaagaagcctggcagacaggcgggcaaacagtga

KEGG   Homo sapiens (human): 27258
Entry
27258             CDS       T01001                                 
Symbol
LSM3, SMX4, USS2, YLR438C
Name
(RefSeq) LSM3 homolog, U6 small nuclear RNA and mRNA degradation associated
  KO
K12622  U6 snRNA-associated Sm-like protein LSm3
Organism
hsa  Homo sapiens (human)
Pathway
hsa03018  RNA degradation
hsa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    27258 (LSM3)
  09123 Folding, sorting and degradation
   03018 RNA degradation
    27258 (LSM3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    27258 (LSM3)
   03041 Spliceosome [BR:hsa03041]
    27258 (LSM3)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     27258 (LSM3)
  mRNA degradation factors
   5'-3' decay
    Lsm complex
     27258 (LSM3)
Spliceosome [BR:hsa03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   LSm proteins
    27258 (LSM3)
 Complex C
  U2 snRNP components
    27258 (LSM3)
SSDB
Motif
Pfam: LSM TIG_SUH vATP-synt_E DUF150_C
Other DBs
NCBI-GeneID: 27258
NCBI-ProteinID: NP_055278
OMIM: 607283
HGNC: 17874
Ensembl: ENSG00000170860
Pharos: P62310(Tdark)
UniProt: P62310
Structure
LinkDB
Position
3:14178817..14201122
AA seq 102 aa
MADDVDQQQTTNTVEEPLDLIRLSLDERIYVKMRNDRELRGRLHAYDQHLNMILGDVEET
VTTIEIDEETYEEIYKSTKRNIPMLFVRGDGVVLVAPPLRVG
NT seq 309 nt   +upstreamnt  +downstreamnt
atggcggacgacgtagaccagcaacaaactaccaacactgtagaggagcccctggatctt
atcaggctcagcctagatgagcgaatttatgtgaaaatgagaaatgaccgagagcttcga
ggcagattacatgcttatgatcaacatttaaatatgatcttgggagatgtggaagaaact
gtgactactatagaaattgatgaagaaacatatgaagagatatataaatcaacgaaacgg
aatattccaatgctctttgtccggggagatggcgttgtcctggttgcccctccactgaga
gttggctga

KEGG   Homo sapiens (human): 51690
Entry
51690             CDS       T01001                                 
Symbol
LSM7, YNL147W
Name
(RefSeq) LSM7 homolog, U6 small nuclear RNA and mRNA degradation associated
  KO
K12626  U6 snRNA-associated Sm-like protein LSm7
Organism
hsa  Homo sapiens (human)
Pathway
hsa03018  RNA degradation
hsa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    51690 (LSM7)
  09123 Folding, sorting and degradation
   03018 RNA degradation
    51690 (LSM7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    51690 (LSM7)
   03041 Spliceosome [BR:hsa03041]
    51690 (LSM7)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     51690 (LSM7)
  mRNA degradation factors
   5'-3' decay
    Lsm complex
     51690 (LSM7)
Spliceosome [BR:hsa03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   LSm proteins
    51690 (LSM7)
SSDB
Motif
Pfam: LSM
Other DBs
NCBI-GeneID: 51690
NCBI-ProteinID: NP_057283
OMIM: 607287
HGNC: 20470
Ensembl: ENSG00000130332
Pharos: Q9UK45(Tdark)
UniProt: Q9UK45
Structure
LinkDB
Position
19:complement(2321521..2328586)
AA seq 103 aa
MADKEKKKKESILDLSKYIDKTIRVKFQGGREASGILKGFDPLLNLVLDGTIEYMRDPDD
QYKLTEDTRQLGLVVCRGTSVVLICPQDGMEAIPNPFIQQQDA
NT seq 312 nt   +upstreamnt  +downstreamnt
atggcggataaggagaagaagaaaaaggagagcatcttggacttgtccaagtacatcgac
aagacgatccgggtaaagttccagggaggccgcgaagccagtggaatcctgaagggcttc
gacccactcctcaaccttgtgctggacggcaccattgagtacatgcgagaccctgacgac
cagtacaagctcacggaggacacccggcagctgggcctcgtggtgtgccggggcacgtcc
gtggtgctaatctgcccgcaggacggcatggaggccatccccaaccccttcatccagcag
caggacgcctag

KEGG   Homo sapiens (human): 51691
Entry
51691             CDS       T01001                                 
Symbol
LSM8, NAA38
Name
(RefSeq) LSM8 homolog, U6 small nuclear RNA associated
  KO
K12627  U6 snRNA-associated Sm-like protein LSm8
Organism
hsa  Homo sapiens (human)
Pathway
hsa03018  RNA degradation
hsa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    51691 (LSM8)
  09123 Folding, sorting and degradation
   03018 RNA degradation
    51691 (LSM8)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    51691 (LSM8)
   03041 Spliceosome [BR:hsa03041]
    51691 (LSM8)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     51691 (LSM8)
  mRNA degradation factors
   5'-3' decay
    Lsm complex
     51691 (LSM8)
Spliceosome [BR:hsa03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   LSm proteins
    51691 (LSM8)
SSDB
Motif
Pfam: LSM Gemin6
Other DBs
NCBI-GeneID: 51691
NCBI-ProteinID: NP_057284
OMIM: 607288
HGNC: 20471
Ensembl: ENSG00000128534
Pharos: O95777(Tdark)
UniProt: O95777 A4D0W0
Structure
LinkDB
Position
7:118184164..118204035
AA seq 96 aa
MTSALENYINRTVAVITSDGRMIVGTLKGFDQTINLILDESHERVFSSSQGVEQVVLGLY
IVRGDNVAVIGEIDEETDSALDLGNIRAEPLNSVAH
NT seq 291 nt   +upstreamnt  +downstreamnt
atgacgtccgctttggagaactacatcaaccgaactgttgccgttattacatcagatggg
agaatgattgtgggaacactgaaaggttttgaccagaccattaatttgattttggatgaa
agccatgaacgagtattcagctcttcacagggggtagaacaagtggtactaggattatac
attgtaagaggtgacaacgttgcagtcattggagaaatcgatgaagaaacagattctgcg
cttgatttggggaatattcgagcagaacctttaaattctgtagcacactga

KEGG   Homo sapiens (human): 57819
Entry
57819             CDS       T01001                                 
Symbol
LSM2, C6orf28, G7B, YBL026W, snRNP
Name
(RefSeq) LSM2 homolog, U6 small nuclear RNA and mRNA degradation associated
  KO
K12621  U6 snRNA-associated Sm-like protein LSm2
Organism
hsa  Homo sapiens (human)
Pathway
hsa03018  RNA degradation
hsa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    57819 (LSM2)
  09123 Folding, sorting and degradation
   03018 RNA degradation
    57819 (LSM2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    57819 (LSM2)
   03041 Spliceosome [BR:hsa03041]
    57819 (LSM2)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     57819 (LSM2)
  mRNA degradation factors
   5'-3' decay
    Lsm complex
     57819 (LSM2)
Spliceosome [BR:hsa03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   LSm proteins
    57819 (LSM2)
 Complex C
  U2 snRNP components
    57819 (LSM2)
SSDB
Motif
Pfam: LSM SM-ATX DYW_deaminase
Other DBs
NCBI-GeneID: 57819
NCBI-ProteinID: NP_067000
OMIM: 607282
HGNC: 13940
Ensembl: ENSG00000204392
Pharos: Q9Y333(Tbio)
UniProt: Q9Y333
Structure
LinkDB
Position
6:complement(31797396..31806966)
AA seq 95 aa
MLFYSFFKSLVGKDVVVELKNDLSICGTLHSVDQYLNIKLTDISVTDPEKYPHMLSVKNC
FIRGSVVRYVQLPADEVDTQLLQDAARKEALQQKQ
NT seq 288 nt   +upstreamnt  +downstreamnt
atgctcttctattcttttttcaagtcccttgtgggcaaggatgtggtcgtggaactaaag
aatgacctgagcatctgtggaaccctccattctgtggatcagtatctcaacatcaaacta
actgacatcagtgtcacagaccctgagaaataccctcacatgttatcagtgaagaactgc
ttcattcggggctcagtggtccgatacgtgcagctgccagcagatgaggtcgacacacag
ttgctacaggatgcggcaaggaaggaagccctgcagcagaaacagtga

DBGET integrated database retrieval system